• Oncology Research Unit, Pfizer Worldwide Research and Development, 10777 Science Center Drive, San Diego, California 92121, United States.

EGFR2(786−805) peptide was synthesized and purified to 98% purity (CPC Scientific). Activation loop peptides were synthesized to >90% purity (Pfizer, La Jolla): VEGFR2 (Ac-LARDIYKDPDYVR-K KDR-tide); cMet (Ac-LARDMYDKEYYSK, METtide; MET2 Ac-ARDMYDKEYYSVHN-K). The C-terminal cMet peptide (Ac-ARDMYDKEYYSVHNK) was synthesized (Pfizer, La Jolla) to >90% purity.

"The peptides TH-(1-43), i.e. MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE, and its Ser19-phosphorylated counterpart THp-(1-43), i.e. MPTPDATTPQAKGFRRAVS(PO3)ELDAKQAEAIMSPRFIGRRQSLIE, were synthesized by CPC Scientific (San Jose, CA, USA) at approx. 90% purity, as seen by mass spectroscopy."

Glucitol-Lys(NOTA)-DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-OH

"Thrombin-sensitive peptide (ThS-P) azidoacetyl alanine-K(5FAM)GALVPRGSAGK(CPQ2) was custom synthesized (2143 MW, > 95% purity; CPC scientific, Sunnyale, CA, USA) and dissolved in DMSO (20 mm ThS-P)."

• Departments of Molecular Biomarkers, Cardiovascular Diseases, and Clinical Pharmacology, Merck Research Laboratories, Rahway, New Jersey, United States.

"Peptide Stable isotope–labeled internal standard peptide (Q 7 and K 15 reciprocally cross-linked dimer of LTIGEGQQHHL*GGAKQAGDV, where L* represents 13 C 6 , 15 N 1 -labeled leucine) was synthesized and analyzed for purity and amino acid content (CPC Scientific)"

"..folded HD5 was generated from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by thiol disulfide reshuffling overnight at room temperature in the presence of 3 mM reduced and 0.3 mM oxidized glutathione, 2 M guanidine hydrochloride, and 0.25 M sodium bicarbonate, pH 8.3, at a peptide concentration of 0.25 mg/ml [..] All α-defensins were quantified by UV absorbance at 280 nm using calculated molar extinction coefficients (18)."

"[..] polyserine tract of AmVg and NvVg were synthesized by CPC Scientific (Sunnyvale, CA, USA) for NMR analysis. The synthesis was performed after isotope-labeling expression attempts in Escherichia coli were deemed unsuitable [..] The peptides had the following sequences: AmVg (residues 358–392): EKLKQDILNLRTDISTS(Sp)SS(15I)SSSEENDFWQPKPT AmVg (residues 336–385): R(15V)SKT(15A)MNSNQI(15V)SDNS(15L)-(15S)STEEK(15L)KQDI(15L)N(15L)RTDI(15S)S(15S)(Sp)S(15A)IS (15S)(15S)EEND. NvVg (residues 351–385): EHKHSDESTSE(Sp)FES(15I)ADNNDDSYFQRKPKLTEAP." NvVg (residues 335–372): RPNK(15L)N(15L)QRRHDHKS(15G)EHKHSDE(15S)S-(15S)E(Sp)FE(15A)I(15A)DNNDD.

"The biotinylated synthetic LDLR peptide [Biotin-PEG8-SINFDNPVYQKT (CPC Scientific)] was captured to ≈20–50 RU, whereas ≈200 RU of the J.D. mutant peptide (Biotin-PEG8-SINFDNPVCQKT) was required for proper detection of ARH binding."

• Pfizer Global Research and Development, Department of Oncology, La Jolla, CA, USA

"Epitope mapping studies were carried out using an overlapping series of synthetic peptides (CPC Scientific, CA) designed based on the primary sequence of OPN. Peptides corresponding to the region 143-172 of human OPN are listed below [..]"

• Global Research & Development, Pfizer, Inc., Groton, CT 06340, USA

Uncapped peptides containing both an amine and carboxyl terminus were synthesized by CPC Scientific Inc. (San Jose, CA) for this research. The linear isomeric peptides exhibited high water solubility (e.g. 1 mg/mL).