Yu, Yang, et al. Science China Life Sciences 57.1 (2014): 117-127.
"The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."
Zekavat, Behrooz, et al. J. Am. for Mass Spectrometry 25.2 (2014): 226-236.
"The synthesized cyclo-(RPKPQQFFGL) peptide and human angiotensin II were purchased from CPC Scientific (CPC Scientific Inc., Sunnyvale, CA, USA)."
Xu, Y., Cai, T.Q., Castriota, G., Zhou, Y., Hoos, L., Jochnowitz, N., Loewrigkeit, C., Cook, J.A., Wickham, A., Metzger, J.M. and Ogletree, M.L. Thrombosis and Haemostasis 111, no. 04 (2014): 694-704.
- Departments of Thrombosis, Cardiometabolic Diseases and In Vivo Pharmacology, Merck Research Laboratories, Kenilworth, New Jersey, USA
CHG-GR-AFC (CPC Scientific, Sunnyvale, CA, USA) was used for rabbit FIXa and FXa, and human activated protein C.
Wang, Xuelian, et al. Vaccine 31.49 (2013): 5806-5813.
“…four current good manufacturing practice-grade HPV16 E6 peptides [E6 1-45, E6 46-80, E6 81-115, and E6 116-158 (referred to as “peptides” hereafter); 10 μg/ml/peptide; made by CPC Scientific, Sunnyvale, CA…”
Hongtao Zhang, Francesca Curreli, Abdul A Waheed, Peter Y Mercredi, Mansi Mehta, Pallavi Bhargava, Daniel Scacalossi, Xiaohe Tong, Shawn Lee, Alan Cooper, Michael F Summers, Eric O Freed & Asim K Debnath Retrovirology 10.1 (2013).
In this report, we expanded the study to i,i+7 hydrocarbon-stapled peptides to delineate their mechanism of action and antiviral activity. We identified three potent inhibitors, NYAD-36, -66 and -67, which showed strong binding to CA in NMR and isothermal titration calorimetry (ITC) studies and disrupted the formation of mature-like particles. They showed typical α-helical structures and penetrated cells; however, the cell penetration was not as efficient as observed with the i,i+4 peptides.
Zhen, Eugene Y., Richard E. Higgs, and Jesus A. Gutierrez. Analytical Biochemistry 442.1 (2013): 1-9.
"Both the stable isotope-labeled (SIL) and unlabeled apelin peptides [apelin-36, apelin-17, apelin-13, (pyr)apelin-13, and apelin-12] were synthesized by CPC Scientific (Sunnyvale, CA, USA)."
Magee, T.V., Brown, M.F., Starr, J.T., Ackley, D.C., Abramite, J.A., Aubrecht, J., Butler, A., Crandon, J.L., Dib-Hajj, F., Flanagan, M.E. and Granskog, K. Journal of Medicinal Chemistry 56, no. 12 (2013): 5079-5093.
- Pfizer Worldwide Research & Development, Pfizer, Inc., Groton, Connecticut 06340, United States
- CPC Scientific, Hangzhou, P.R. China
Sturm, Matthew B., et al. Science Translational Medicine 5.184 (2013): 184ra61-184ra61.
“For the clinical and pharmacology/toxicology studies, ASY*-FITC was GMP synthesized (CPC Scientific). Stability was evaluated by appearance (color), HPLC, and mass spectrometry for 3 years. The pharmacology/toxicology study in rats was conducted in accordance with FDA CFR title 21, part 58…”
Sun, Tzu-Lin, et al. Biophysical Journal 104.9 (2013): 1923-1932.
"NYAD-1 is H - Ile - Thr - Phe - X - Asp - Leu - Leu - X - Tyr - Tyr - Gly - Pro - NH2 (with special cyclization to get double bond, X = (S) - alpha - (2′-pentenyl)alanine) (4). NYAD-1 and CAI (H-Ile-Thr-Phe-Glu-Asp-Leu-Leu-Asp-Tyr-Tyr-Gly-Pro-NH2) were synthesized by CPC Scientific (San Jose, CA) under the supervision of Xiaohe Tong"
Lin, Mai, Michael J. Welch, and Suzanne E. Lapi. Molecular Imaging and Biology 15.5 (2013): 606-613.
"DOTA-[Tyr3]octreotide and NO2A-[Tyr3]octreotide were purchased from CPC Scientific (Sunnyvale, CA)."
