Skip to content
  • Medtide Inc.
  • CPC Scientific Inc.
  • Company
  • Careers
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • My Account
    • Register
  • Cart0
    CPC Scientific

    A subsidiary of
    Medtide Inc.
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Peptide Synthesis
        • Custom Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Browse Catalog
          • Browse by Category
          • Search
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide–Oligo Conjugate Services
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Contact
    • Quote
      • Quotation Request
      • Frequently Asked Questions
    • Medtide Inc.
    • CPC Scientific Inc.

    CPC Scientific

    A subsidiary of
    Medtide Inc.
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Peptide Synthesis
        • Custom Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Browse Catalog
          • Browse by Category
          • Search
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide–Oligo Conjugate Services
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Contact
    • Quote
      • Quotation Request
      • Frequently Asked Questions
    1. Home
    2. Posts
    3. Phosphorylated Peptides

    Phosphorylated Peptides Archive

    • PRMT5 C-terminal Phosphorylation Modulates a 14-3-3/PDZ Interaction Switch.

      Espejo, Alexsandra B., et al. Journal of Biological Chemistry 292.6 (2017): 2255-2265.

      "PRMT5pT634 (Biotin-SAIHNPTGRSYpTIGL-COOH, where pT represents phosphothreonine), PGHS2 (Biotin-SGSGVLIKRRSTEL-COOH),PGHS2pT602 (Biotin-SGSGVLIKRRSpTEL-COOH), IRK1 (Biotin-SGSGPRPLRRESEI-COOH), IRK1pS425 (BiotinSGSGPRPLRREpSEI-COOH, where pS represents phosphoserine), ERBB4 (Biotin-GTVLPPPPYRHRNTVV-COOH), and ERBB4pT1306 (Biotin-GTVLPPPPYRHRNpTVV-COOH)) and by CPC Scientific, Inc. (E6 (HPV16) (Biotin-RSSRTRRETQLCOOH) and E6 (HPV16)pT156 (Biotin-RSSRTRREpTQLCOOH))."

      Published On: September 24th, 2016Categories: Citations, Phosphorylated Peptides
      Learn More
    • The N-terminal sequence of tyrosine hydroxylase is a conformationally versatile motif that binds 14-3-3 proteins and membranes.

      Skjevik, Ã…ge Aleksander, et al. Journal of Molecular Biology 426.1 (2014): 150-168.

      "The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."

      Published On: January 9th, 2014Categories: Citations, Long Sequences, Phosphorylated Peptides
      Learn More
    • The peripheral binding of 14-3-3γ to membranes involves isoform-specific histidine residues.

      Bustad, Helene J., Lars Skjaerven, Ming Ying, Øyvind Halskau, Anne Baumann, David Rodriguez-Larrea, Miguel Costas, Jarl Underhaug, Jose M. Sanchez-Ruiz, and Aurora Martinez. PloS One 7, no. 11 (2012): e49671.

      "The peptides TH-(1-43), i.e. MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE, and its Ser19-phosphorylated counterpart THp-(1-43), i.e. MPTPDATTPQAKGFRRAVS(PO3)ELDAKQAEAIMSPRFIGRRQSLIE, were synthesized by CPC Scientific (San Jose, CA, USA) at approx. 90% purity, as seen by mass spectroscopy."

      Published On: November 26th, 2012Categories: Citations, Phosphorylated Peptides
      Learn More
    • A vitellogenin polyserine cleavage site: highly disordered conformation protected from proteolysis by phosphorylation.

      Havukainen, Heli, et al. The Journal of Experimental Biology 215.11 (2012): 1837-1846.

      "[..] polyserine tract of AmVg and NvVg were synthesized by CPC Scientific (Sunnyvale, CA, USA) for NMR analysis. The synthesis was performed after isotope-labeling expression attempts in Escherichia coli were deemed unsuitable [..] The peptides had the following sequences: AmVg (residues 358–392): EKLKQDILNLRTDISTS(Sp)SS(15I)SSSEENDFWQPKPT AmVg (residues 336–385): R(15V)SKT(15A)MNSNQI(15V)SDNS(15L)-(15S)STEEK(15L)KQDI(15L)N(15L)RTDI(15S)S(15S)(Sp)S(15A)IS (15S)(15S)EEND. NvVg (residues 351–385): EHKHSDESTSE(Sp)FES(15I)ADNNDDSYFQRKPKLTEAP." NvVg (residues 335–372): RPNK(15L)N(15L)QRRHDHKS(15G)EHKHSDE(15S)S-(15S)E(Sp)FE(15A)I(15A)DNNDD.

      Published On: May 9th, 2012Categories: Citations, Isotope-Labeled Peptides, Phosphorylated Peptides
      Learn More
    • Design and NMR Studies of Cyclic Peptides Targeting the N-Terminal Domain of the Protein Tyrosine Phosphatase YopH.

      Leone, Marilisa, et al. Chemical Biology & Drug Design 77.1 (2011): 12-19.

      "Cyclo-DEYDDPfK; Cyclo-DE(pY)LDPfK; Cyclo-DE(FCOOH)LDPfK (FCOOH= phenylalanine with a carboxyl group at the para position) were purchased either from the MCW facility of the Wisconsin Medical College or from CPC Scientific (San José, CA, USA)"

      Published On: November 30th, 2010Categories: Citations, D-Amino Acids, Peptide Macrocycles, Phosphorylated Peptides, Showcase Phosphorylation
      Learn More
    • Transition metal complex cations as reagents for gas-phase transformation of multiply deprotonated polypeptides.

      Crizer, David M., Yu Xia, and Scott A. McLuckey. Journal of the American Society for Mass Spectrometry 20.9 (2009): 1718-1722.

      Phosphopeptide LPISASHpSpSKTR was synthesized by CPC Scientific (San Jose, CA, USA). Both peptides were diluted to a concentration of 20 μM in 49/49/2 (vol/vol/vol) methanol/water/ammonium hydroxide solution."

      Published On: September 5th, 2009Categories: Citations, Phosphorylated Peptides
      Learn More
    CPC Scientific Logo Tides Partner and Peptide Manufacturer

    Our Manufacturing Services

    GMP Peptide Manufacturing
    GMP Oligonucleotide Manufacturing
    Custom Peptide Synthesis
    Oligonucleotide Services
    Peptide–Oligonucleotide Conjugates
    Generic Peptides
    FTE Services
    • GMP Peptide Manufacturing
    • GMP Oligonucleotide Manufacturing
    • Custom Peptide Synthesis
    • Oligonucleotide Services
    • Peptide Oligonucleotide ConjugatesNEW
    • Generic Peptides
    • FTE Services

    Resources & Support

    • Knowledge Center
    • Frequently Asked Questions
    • Contact Us

    Company

    • About Us
    • Group History
    • Press Releases
    • Scheduled Events
    • Careers

    Catalog Peptide Orders

    • Shop
    • Orders
    • Shipping Conditions
    • Order FAQs

    Get in Touch

    • Contact Us
    • Request Quotation
    • Subscribe to Newsletter
    sales@cpcscientific.com
    +1 (408) 734-3800
    sales@cpcscientific.com
    +1 (408) 734-3800

    Copyright © 2026 CPC Scientific Inc. All Rights Reserved.

    • Terms and Conditions
    • Privacy Policy
    Page load link
    The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy. Accept Reject
    Go to Top