Antimicrobial Peptides (AMPs) are found in virtually every living organism—bacteria, fungi, plants, invertebrates, and vertebrates—and play a critical role in the innate and acquired immune responses to pathogenic attacks. AMPs are released by various cells and organelles, such as immune cells (granulocytes and macrophages), epithelial cells (vaginal epithelium, respiratory epithelium, and oral cavity epithelium), and the small intestine.
Line, J.E.; Seal, B.S.; Garrish, J.K. Appl. Microbiol. 2022, 2, 688–700.
Peptides were synthesized using standard solid-phase(Fmoc) chemistry with a peptide synthesizer (CPC Scientific Inc., Sunnyvale, CA 94089,USA, C12K-2β12 [..]
Alford, M. A.; Choi, K.-Y. G.; Trimble, M. J.; Masoudi, H.; Kalsi, P.; Pletzer, D.; Hancock, R. E., Frontiers in Cellular and Infection Microbiology 2021, 2021, 11, 75.
"Peptides IDR-1018 (VRLIVAVRIWRR-NH2) (Achtman et al., 2012), DJK-5 (all D-amino acids vqwrairvrvir-NH2) (de la Fuente-Nunez et al., 2015) and IDR-1002 (VQRWLIVWRIRK-NH2) (Nijnik et al., 2010), were synthesized by CPC Scientific [..]"
Zhang, T.; Xia, L.; Wang, Z.; Hancock, R. E.; Haapasalo, M., Journal of Endodontics 2021, 47 (3), 466-471.
"Peptides DJK-5 and 1018 were synthesized using solid-phase 9-fluorenylmethoxy carbonyl chemistry and purified to a purity of >95% using reverse-phase high-performance liquid chromatography by CPC Scientific (Sunnyvale, CA) as previously described [..]"
Wuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.
"LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."
Coorens, Maarten, et al. The Journal of Immunology 199.4 (2017): 1418-1428.
"CATH-2 and LL-37 were synthesized by Fmoc-chemistry at CPC Scientific (Sunnyvale, CA)."
Wilson, Sarah S., et al. PLoS Pathogens 13.6 (2017): e1006446.
"Cryptdin 2 (UniProtKB: P28309, LRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR)... obtained by oxidative refolding of partially purified linear peptides (synthesized by CPC Scientific...) and purifying the correctly folded species by reverse-phase high-pressure liquid chromatography (RP-HPLC). Purity was determined by analytical RP-HPLC, and the mass of the disulfide-bonded peptides was verified by high mass accuracy liquid chromatography-mass spectrometry."
Huang, Chung-Guei, et al. Oncotarget 8.21 (2017): 34820-34835
"Synthetic peptides of HPV 16 L1 (N′-C-KHTPPAPKEDPLKK-C′; position: 456−471)/E6 (N′-C-RTAMFQDPQERPRK-C′; position: 5−18) and a recombination protein of full-length HPV 16 E7-histag fusion protein (N′-MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEED-EIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL-CVQSTHVDIRTLEDLLMGTLGIVCPICSQKP-C′; position: 1−98) were manufactured by CPC Scientific Inc."
Fumakia, M. MS Thesis, University of Manitoba 2016.
LL37 (host defense peptide) (Table 2) was a purchased from (custom synthesized by CPC Scientific Inc., CA, USA)
Wilson, Sarah S., et al. Mucosal Immunology 8.2 (2015): 352-361.
"Folded Crp23 was created from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by the same procedure as previously reported for the α-defensin HD5"

