Skip to content
  • Medtide Inc.
  • CPC Scientific Inc.
  • Company
  • Careers
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • My Account
    • Register
  • Cart0
    CPC Scientific

    A subsidiary of
    Medtide Inc.
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Peptide Synthesis
        • Custom Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Browse Catalog
          • Browse by Category
          • Search
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide–Oligo Conjugate Services
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Contact
    • Quote
      • Quotation Request
      • Frequently Asked Questions
    • Medtide Inc.
    • CPC Scientific Inc.

    CPC Scientific

    A subsidiary of
    Medtide Inc.
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Peptide Synthesis
        • Custom Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Browse Catalog
          • Browse by Category
          • Search
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide–Oligo Conjugate Services
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Contact
    • Quote
      • Quotation Request
      • Frequently Asked Questions
    1. Home
    2. Posts
    3. Antimicrobial Peptides

    Antimicrobial Peptides Archive

    • Antimicrobial Peptide Brochure Request

      Antimicrobial Peptides (AMPs) are found in virtually every living organism—bacteria, fungi, plants, invertebrates, and vertebrates—and play a critical role in the innate and acquired immune responses to pathogenic attacks. AMPs are released by various cells and organelles, such as immune cells (granulocytes and macrophages), epithelial cells (vaginal epithelium, respiratory epithelium, and oral cavity epithelium), and the small intestine.

      Published On: February 5th, 2024Categories: Antimicrobial Peptides, Brochure Request, Brochures
      Learn More
    • Selected Antimicrobial Peptides Inhibit In Vitro Growth of Campylobacter spp.

      Line, J.E.; Seal, B.S.; Garrish, J.K. Appl. Microbiol. 2022, 2, 688–700.

      Peptides were synthesized using standard solid-phase(Fmoc) chemistry with a peptide synthesizer (CPC Scientific Inc., Sunnyvale, CA 94089,USA, C12K-2β12 [..]

      Published On: September 23rd, 2022Categories: Antimicrobial Peptides, Citations
      Learn More
    • Murine Model of Sinusitis Infection for Screening Antimicrobial and Immunomodulatory Therapies.

      Alford, M. A.; Choi, K.-Y. G.; Trimble, M. J.; Masoudi, H.; Kalsi, P.; Pletzer, D.; Hancock, R. E., Frontiers in Cellular and Infection Microbiology 2021, 2021, 11, 75.

      "Peptides IDR-1018 (VRLIVAVRIWRR-NH2) (Achtman et al., 2012), DJK-5 (all D-amino acids vqwrairvrvir-NH2) (de la Fuente-Nunez et al., 2015) and IDR-1002 (VQRWLIVWRIRK-NH2) (Nijnik et al., 2010), were synthesized by CPC Scientific [..]"

      Published On: March 12th, 2021Categories: Antimicrobial Peptides, Citations, D-Amino Acids
      Learn More
    • Recovery of Oral In Vitro Biofilms after Exposure to Peptides and Chlorhexidine.

      Zhang, T.; Xia, L.; Wang, Z.; Hancock, R. E.; Haapasalo, M., Journal of Endodontics 2021, 47 (3), 466-471.

      "Peptides DJK-5 and 1018 were synthesized using solid-phase 9-fluorenylmethoxy carbonyl chemistry and purified to a purity of >95% using reverse-phase high-performance liquid chromatography by CPC Scientific (Sunnyvale, CA) as previously described [..]"

      Published On: March 1st, 2021Categories: Antimicrobial Peptides, D-Amino Acids
      Learn More
    • Synthetic host defense peptide IDR-1002 reduces inflammation in Pseudomonas aeruginosa lung infection.

      Wuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.

      "LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."

      Published On: November 6th, 2017Categories: Antimicrobial Peptides, Citations
      Learn More
    • Cathelicidins Inhibit Escherichia coli–Induced TLR2 and TLR4 Activation in a Viability-Dependent Manner.

      Coorens, Maarten, et al. The Journal of Immunology 199.4 (2017): 1418-1428.

      "CATH-2 and LL-37 were synthesized by Fmoc-chemistry at CPC Scientific (Sunnyvale, CA)."

      Published On: August 15th, 2017Categories: Antimicrobial Peptides, Citations
      Learn More
    • Alpha-defensin-dependent enhancement of enteric viral infection.

      Wilson, Sarah S., et al. PLoS Pathogens 13.6 (2017): e1006446.

      "Cryptdin 2 (UniProtKB: P28309, LRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR)... obtained by oxidative refolding of partially purified linear peptides (synthesized by CPC Scientific...) and purifying the correctly folded species by reverse-phase high-pressure liquid chromatography (RP-HPLC). Purity was determined by analytical RP-HPLC, and the mass of the disulfide-bonded peptides was verified by high mass accuracy liquid chromatography-mass spectrometry."

      Published On: June 16th, 2017Categories: Antimicrobial Peptides, Citations, Multiple Disulfide Bridges
      Learn More
    • Molecular and serologic markers of HPV 16 infection are associated with local recurrence in patients with oral cavity squamous cell carcinoma.

      Huang, Chung-Guei, et al. Oncotarget 8.21 (2017): 34820-34835

      "Synthetic peptides of HPV 16 L1 (N′-C-KHTPPAPKEDPLKK-C′; position: 456−471)/E6 (N′-C-RTAMFQDPQERPRK-C′; position: 5−18) and a recombination protein of full-length HPV 16 E7-histag fusion protein (N′-MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEED-EIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL-CVQSTHVDIRTLEDLLMGTLGIVCPICSQKP-C′; position: 1−98) were manufactured by CPC Scientific Inc."

      Published On: March 31st, 2017Categories: Antimicrobial Peptides, Long Sequences, Multiple Disulfide Bridges
      Learn More
    • Topical nanomedicine for the combination delivery of immuno-modulatory peptides for accelerated chronic wound healing and anti-bacterial activity.

      Fumakia, M. MS Thesis, University of Manitoba 2016.

      LL37 (host defense peptide) (Table 2) was a purchased from (custom synthesized by CPC Scientific Inc., CA, USA)

      Published On: July 22nd, 2016Categories: Antimicrobial Peptides, Citations, Cosmetic Peptides
      Learn More
    • A small intestinal organoid model of non-invasive enteric pathogen–epithelial cell interactions.

      Wilson, Sarah S., et al. Mucosal Immunology 8.2 (2015): 352-361.

      "Folded Crp23 was created from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by the same procedure as previously reported for the α-defensin HD5"

      Published On: August 13th, 2014Categories: Antimicrobial Peptides, Citations, Multiple Disulfide Bridges
      Learn More
    12Next
    CPC Scientific Logo Tides Partner and Peptide Manufacturer

    Our Manufacturing Services

    GMP Peptide Manufacturing
    GMP Oligonucleotide Manufacturing
    Custom Peptide Synthesis
    Oligonucleotide Services
    Peptide–Oligonucleotide Conjugates
    Generic Peptides
    FTE Services
    • GMP Peptide Manufacturing
    • GMP Oligonucleotide Manufacturing
    • Custom Peptide Synthesis
    • Oligonucleotide Services
    • Peptide Oligonucleotide ConjugatesNEW
    • Generic Peptides
    • FTE Services

    Resources & Support

    • Knowledge Center
    • Frequently Asked Questions
    • Contact Us

    Company

    • About Us
    • Group History
    • Press Releases
    • Scheduled Events
    • Careers

    Catalog Peptide Orders

    • Shop
    • Orders
    • Shipping Conditions
    • Order FAQs

    Get in Touch

    • Contact Us
    • Request Quotation
    • Subscribe to Newsletter
    sales@cpcscientific.com
    +1 (408) 734-3800
    sales@cpcscientific.com
    +1 (408) 734-3800

    Copyright © 2026 CPC Scientific Inc. All Rights Reserved.

    • Terms and Conditions
    • Privacy Policy
    Page load link
    The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy.
    Accept Reject
    Go to Top