"The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."

Abstract

Tyrosine hydroxylase (TH) catalyzes the rate limiting step in the synthesis of catecholamine neutrotransmitters, and a reduction of TH activity is associated with several neurological diseases. Human TH is regulated, among other mechanisms, by Ser19-phosphorylation-dependent interaction with 14-3-3 proteins. The N-terminal sequence (residues 1-43), which corresponds to an extension to the TH regulatory domain, also interacts with negatively charged membranes. By using X-ray crystallography together with molecular dynamics simulations and structural bioinformatics analysis, we have probed the conformations of the Ser19-phosphorylated N-terminal peptide (THp-(1-43)), bound to 14-3-3γ, free in solution and bound to a phospholipid bilayer, and of the unphosphorylated peptide TH-(1-43) both free and bilayer-bound. As seen in the crystal structure of THp-(1-43) complexed with 14-3-3γ, the region surrounding pSer19 adopts an extended conformation in the bound state, whereas THp-(1-43) adopts a bent conformation when free in solution, with higher content of secondary structure and higher number of internal hydrogen bonds. TH-(1-43) in solution presents the highest mobility and least defined structure of all forms studied, and it shows an energetically more favorable interaction with membranes relative to THp-(1-43). Cationic residues, notably Arg15 and Arg16, which are the recognition sites of the kinases phosphorylating at Ser19, are also contributing to the interaction with the membrane. Our results reveal the structural flexibility of this region of TH, in accordance with the functional versatility and conformational adaptation to different partners. Furthermore, this structural information has potential relevance for the development of therapeutics for neurodegenerative disorders, through modulation of TH-partner interactions.

SOCIAL MEDIA

Connect with us and stay updated by following our social media channels.

Latest Briefings from our Knowledge Center

Press Releases, Industry News, Articles, and Technical Content

  • Umberger, T.S., Ming, W., Cox, J.M., Konrad, R.J. and Siegel, R.W. Bioanalysis 14, no. 18 (2022): 1229-1239.

    • Lilly Research Laboratories, Eli Lilly & Company, Indianapolis, IN46285, USA

    Human K2 EDTA and P800 plasma (500 μl) was spiked with proglucagon 33–61, 35–61 and 36–61 stable-isotope-labeled internal standard peptides (CPC Scientific, custom order) and diluted with I buffer (25 mmol/l Tris-HCl, 25 mmol/l HEPES, 300 mmol/l NaCl, 0.1% (v/v) octyl β-D-glucopyranoside, pH 7.5).

  • Line, J.E.; Seal, B.S.; Garrish, J.K. Appl. Microbiol. 2022, 2, 688–700.

    Peptides were synthesized using standard solid-phase(Fmoc) chemistry with a peptide synthesizer (CPC Scientific Inc., Sunnyvale, CA 94089,USA, C12K-2β12 [..]

    September 23rd, 2022Antimicrobial Peptides, Citations
  • Kirk, N.S., Chen, Q., Wu, Y.G., Asante, A.L., Hu, H., Espinosa, J.F., Martínez-Olid, F., Margetts, M.B., Mohammed, F.A., Kiselyov, V.V. and Barrett, D.G. Nature Communications 13, no. 1 (2022): 5695.

    • Eli Lilly and Company, Lilly Corporate Center, Indianapolis, IN 46285, USA.

    Peptides were synthesized under contract by CPC Scientific, except for the N-terminally acetylated version of IM172N22 and the Glu3Arg, Glu3Ala, Glu4Arg, Glu4Ala, Glu5Ala, Glu5Arg, Trp6Ala, Gln8Ala, Ile9Ala, Glu10Ala, Glu10Arg and Tyr14Ala mutants of IM172N22

    September 12th, 2022Citations
  • Coskun, T., Urva, S., Roell, W.C., Qu, H., Loghin, C., Moyers, J.S., O’Farrell, L.S., Briere, D.A., Sloop, K.W., Thomas, M.K. and Pirro, V. Cell Metabolism 34, no. 9 (2022): 1234-1247.

    • Eli Lilly and Company, Lilly Corporate Center, Indianapolis, IN 46285, USA

    Homologous and heterologous competition experiments were performed with non-radioactive peptide analogues[127I]-Tyr1-GIP(1-42) and [127]-Tyr10-GIP(1-42) to ensure quantification of the high-affinity binding site of the GIPR. Peptide analogues were generated using synthetic [127I]-Tyr amino acid building blocks (CPC Scientific).

  • Cecil, D.L., Curtis, B., Gad, E., Gormley, M., Timms, A.E., Corulli, L., Bos, R., Damle, R.N., Sepulveda, M.A. and Disis, M.L. Scientific Reports 12, no. 1 (2022): 13618.

    1. Cancer Vaccine Institute, University of Washington, 850 Republican Street, Brotman Bld., 2nd Floor, Box 358050, Seattle, WA 98195-8050, USA.
    2. Janssen Research and Development LLC, Spring House, PA, USA.
    3. Janssen Vaccines and Prevention, Leiden, The Netherlands.

    The peptides were constructed and purified by high-performance liquid chromatography (> 90% pure; CPC Scientific).

    August 10th, 2022Citations
  • Zonari, A., Brace, L.E., Alencar-Silva, T., Porto, W.F., Foyt, D., Guiang, M., Cruz, E.A.O., Franco, O.L., Oliveira, C.R., Boroni, M. and Carvalho, J.L. Toxicology Reports 9 (2022): 1632-1638.

    Peptide 14 (ETAKHWLKGI) (Sup. Fig. 1) was purchased from CPC Scientific Inc. (USA), which synthesized the peptide by solid phase (Fmoc) on a Rink amide resin, with > 95% purity, in the form of acetate salt.

    August 5th, 2022Citations, Cosmetic Peptides
  • Rocklin API Manufacturing Facility

    CPC Scientific Inc., a leading global peptide CRDMO (Contract Research, Development, and Manufacturing Organization) has invested in a new peptide API (Active Pharmaceutical Ingredient) manufacturing site, bringing many new jobs to Rocklin, California. The 41,000 sq ft facility located at 3880 Atherton Rd, Rocklin, CA 95765 will be utilized to manufacture clinical to commercial grade peptide products for increased manufacturing capacity and will diversify CPC Scientific’s supply chain.

    CPC Scientific is entering an exciting period of growth and innovation for peptide and oligonucleotide therapeutic development and manufacturing, and we will continue to provide therapeutic APIs to pharmaceutical and biotech companies around the world. We are very pleased to partner with the City of Rocklin, California to bring manufacturing and Life-Science jobs to local American workers,” said Shawn Lee, PhD, CEO.

    June 22nd, 2022Press Releases
  • Ikeda, Z., Kakegawa, K., Kikuchi, F., Itono, S., Oki, H., Yashiro, H., Hiyoshi, H., Tsuchimori, K., Hamagami, K., Watanabe, M. and Sasaki, M. Journal of Medicinal Chemistry 65, no. 12 (2022): 8456-8477.

    • Research, Takeda Pharmaceutical Company Limited, 26-1, Muraokahigashi 2-chome, Fujisawa, Kanagawa 251-8555, Japan

    Subsequently, 5FAM–Abu–Gly–Asp–Asp–Asp–Lys–Ile–Val–Gly–Gly–Lys(CPQ2)–Lys–Lys–NH2 (purity: 97.2%, CPC Scientific, Inc.) was diluted with an assay buffer to prepare a 2.1 μM substrate solution.

  • FRET peptide substrates whitepaper

    The transferred energy from a fluorescent donor is converted into molecular vibrations if the acceptor is a non-fluorescent dye (quencher). When the FRET is terminated (by separating donor and acceptor), an increase of donor fluorescence can be detected. The design and synthesis work at CPC for FRET and TR-FRET peptide substrates include modification of sequences, selection of donor/quencher pairs, improvement of FRET substrate solubility and quenching efficiency.

    May 27th, 2022publications, White Papers

Contact Us