Buss, Colin G., and Sangeeta N. Bhatia. Proceedings of the National Academy of Sciences (2020).
Tandem Peptides. Tandem peptides were purchased from CPC Scientific. Sequences are: mTP-TAMRA-LyP1 (Myr-GWTLNSAGYLLGKINLKALA-ALAKKILGGGGK(5TAMRA)-CGNKRTRGC (C-C bridge)); [..] PEGylated formulations of these peptides were synthesized as previously described (49). The sequences are: [..] mTP-PEG-ARAL (Myr-GWTLNSAGYLLGKINLKALA-ALAKKILC-PEG5K-GGGARALPSQRSR).
Lo, J.H., Hao, L., Muzumdar, M.D., Raghavan, S., Kwon, E.J., Pulver, E.M., Hsu, F., Aguirre, A.J., Wolpin, B.M., Fuchs, C.S. and Hahn, W.C. Molecular Cancer Therapeutics 17, no. 11 (2018): 2377-2388.
pTP-TAMRA-iRGD (CH3(CH)15-[GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge]) used in all figures except Fig. S1 was synthesized by CPC Scientific.
Gilles, Maud-Emmanuelle, Slack, Frank J, et al. Oncotarget, 2019, Vol. 10, (No. 51), pp: 5349-5358
"Tandem peptide (pTP-iRGD: CH3(CH)15-GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge) was synthesized by CPC Scientific."
Weaver, Clarissa L., et al. Biochemistry 56.15 (2017): 2071-2075.
"The peptide, NCysRepA50mer (C MNQSFISDIL YADIESKAKE LTVNSNNTVQ PVALMRLGVF VPKPSKSKGE), was synthesized by CPC Scientific (Sunnyvale, CA). "
Huang, Chung-Guei, et al. Oncotarget 8.21 (2017): 34820-34835
"Synthetic peptides of HPV 16 L1 (N′-C-KHTPPAPKEDPLKK-C′; position: 456−471)/E6 (N′-C-RTAMFQDPQERPRK-C′; position: 5−18) and a recombination protein of full-length HPV 16 E7-histag fusion protein (N′-MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEED-EIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL-CVQSTHVDIRTLEDLLMGTLGIVCPICSQKP-C′; position: 1−98) were manufactured by CPC Scientific Inc."
Skjevik, Ã…ge Aleksander, et al. Journal of Molecular Biology 426.1 (2014): 150-168.
"The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."
