
Nakagawa, Mayumi. U.S. Patent Application No. 14/566,604, filed August 13, 2015.
“To define the minimal and optimal amino acids sequences of the CD8 T-cell epitope, 8-mer, 10-mer, 11-mer, and homologous peptides were synthesized (CPC Scientific, Inc, San Jose, Calif.)… Their safety for human use is ensured, in accordance with FDA requirements…(each peptide to be assessed individually as per the FDA). ”
Latest Briefings from our Knowledge Center
Press Releases, Industry News, Articles, and Technical Content
Skjevik, Åge Aleksander, et al. Journal of Molecular Biology 426.1 (2014): 150-168.
"The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."
January 9th, 2014Citations, Long Sequences, Phosphorylated PeptidesYu, Yang, et al. Science China Life Sciences 57.1 (2014): 117-127.
"The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."
December 26th, 2013Citations, PEGylationZekavat, Behrooz, et al. J. Am. for Mass Spectrometry 25.2 (2014): 226-236.
"The synthesized cyclo-(RPKPQQFFGL) peptide and human angiotensin II were purchased from CPC Scientific (CPC Scientific Inc., Sunnyvale, CA, USA)."
December 18th, 2013Citations, Peptide MacrocyclesXu, Y., Cai, T.Q., Castriota, G., Zhou, Y., Hoos, L., Jochnowitz, N., Loewrigkeit, C., Cook, J.A., Wickham, A., Metzger, J.M. and Ogletree, M.L. Thrombosis and Haemostasis 111, no. 04 (2014): 694-704.
- Departments of Thrombosis, Cardiometabolic Diseases and In Vivo Pharmacology, Merck Research Laboratories, Kenilworth, New Jersey, USA
CHG-GR-AFC (CPC Scientific, Sunnyvale, CA, USA) was used for rabbit FIXa and FXa, and human activated protein C.
December 12th, 2013Citations, Dye-LabeledWang, Xuelian, et al. Vaccine 31.49 (2013): 5806-5813.
“…four current good manufacturing practice-grade HPV16 E6 peptides [E6 1-45, E6 46-80, E6 81-115, and E6 116-158 (referred to as “peptides” hereafter); 10 μg/ml/peptide; made by CPC Scientific, Sunnyvale, CA…”
December 2nd, 2013Citations, GMP Peptide ManufacturingHongtao Zhang, Francesca Curreli, Abdul A Waheed, Peter Y Mercredi, Mansi Mehta, Pallavi Bhargava, Daniel Scacalossi, Xiaohe Tong, Shawn Lee, Alan Cooper, Michael F Summers, Eric O Freed & Asim K Debnath Retrovirology 10.1 (2013).
In this report, we expanded the study to i,i+7 hydrocarbon-stapled peptides to delineate their mechanism of action and antiviral activity. We identified three potent inhibitors, NYAD-36, -66 and -67, which showed strong binding to CA in NMR and isothermal titration calorimetry (ITC) studies and disrupted the formation of mature-like particles. They showed typical α-helical structures and penetrated cells; however, the cell penetration was not as efficient as observed with the i,i+4 peptides.
November 15th, 2013Citations, coauthored, publications, Stapled PeptidesZhen, Eugene Y., Richard E. Higgs, and Jesus A. Gutierrez. Analytical Biochemistry 442.1 (2013): 1-9.
"Both the stable isotope-labeled (SIL) and unlabeled apelin peptides [apelin-36, apelin-17, apelin-13, (pyr)apelin-13, and apelin-12] were synthesized by CPC Scientific (Sunnyvale, CA, USA)."
November 1st, 2013Citations, Isotope-Labeled PeptidesMagee, T.V., Brown, M.F., Starr, J.T., Ackley, D.C., Abramite, J.A., Aubrecht, J., Butler, A., Crandon, J.L., Dib-Hajj, F., Flanagan, M.E. and Granskog, K. Journal of Medicinal Chemistry 56, no. 12 (2013): 5079-5093.
- Pfizer Worldwide Research & Development, Pfizer, Inc., Groton, Connecticut 06340, United States
- CPC Scientific, Hangzhou, P.R. China
June 4th, 2013Citations, coauthored, Peptide Macrocycles, publications, Unnatural Amino AcidsSturm, Matthew B., et al. Science Translational Medicine 5.184 (2013): 184ra61-184ra61.
“For the clinical and pharmacology/toxicology studies, ASY*-FITC was GMP synthesized (CPC Scientific). Stability was evaluated by appearance (color), HPLC, and mass spectrometry for 3 years. The pharmacology/toxicology study in rats was conducted in accordance with FDA CFR title 21, part 58…”
May 8th, 2013Citations, GMP Peptide Manufacturing


