Nakagawa, Mayumi. U.S. Patent Application No. 14/566,604, filed August 13, 2015.
“To define the minimal and optimal amino acids sequences of the CD8 T-cell epitope, 8-mer, 10-mer, 11-mer, and homologous peptides were synthesized (CPC Scientific, Inc, San Jose, Calif.)… Their safety for human use is ensured, in accordance with FDA requirements…(each peptide to be assessed individually as per the FDA). ”
SOCIAL MEDIA
Connect with us and stay updated by following our social media channels.
Latest Briefings from our Knowledge Center
Press Releases, Industry News, Articles, and Technical Content
Longo, Edoardo, et al. International Journal of Pharmaceutics 472.1 (2014): 156-164.
"[palmitoylated peptides] were synthesized by CPC Scientific Inc. (Sunnyvale, CA, USA), each obtained as a white lyophilised powder and stored at 4 °C protected from light. All peptides were synthesized by peptide solid-phase synthesis."
Warren, Andrew D., et al. Journal of the American Chemical Society 136.39 (2014): 13709-13714.
"Thrombin-sensitive reporter 1 (R1) was synthesized by CPC Scientific, with the sequence Biotin-PEG5kDa-Lys(5FAM)-Gly-Gly-DPhe-Pro-Arg-Ser-Gly-Gly-Gly-Cys, where PEG5kDa is 5 kDa poly(ethylene glycol)."
Saenz, Rebecca, et al. J Translational Medicine 12 (2014): 211.
“…Hp91 (DPNAPKRPPSAFFLFCSE), Hp121 (SIGDVAKKLGEMWNNTAA), scrambled Hp91 (ASLAPPFPNCFDPKSREF), and OVA-I (SIINFEKL) were all synthesized at GMP facilities by [..] CPC Scientific (San Jose, CA, USA). Peptides were synthesized with an N-terminal biotin, acetyl, or fluorescent tag (Cp488) as indicated in the figure legends. Peptides were routinely synthesized with greater than 95% purity.”
Wilson, Sarah S., et al. Mucosal Immunology 8.2 (2015): 352-361.
"Folded Crp23 was created from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by the same procedure as previously reported for the α-defensin HD5"
Ng, Quinn KT, et al. Biomaterials 35.25 (2014): 7050-7057.
"Linear and cyclic targeting sequences of the peptides CCVVVT-EG4-GRGDSP-NH2 (97%) (Cap-lRGD) and c[RGDfK(CCVVVT-EG 4 )] (96%) (Cap-cRGD) were purchased from CPC Scientific."
Harper, Brett, Mahsan Miladi, and Touradj Solouki. Journal of The American Society for Mass Spectrometry 25.10 (2014): 1716-1729.
"antipeptide (EGVYVHPV), angiotensin II, human (DRVYIHPF), and isotopically (13C) labeled heptapeptide (AAAAHAA-NH2 [where “A” indicates a carbon thirteen (13C) isotope on the alanine carbonyl group]) were purchased from CPC Scientific Incorporated (Sunnyvale, CA)"
Choi, Ka-Yee G., Scott Napper, and Neeloffer Mookherjee. Immunology 143.1 (2014): 68-80.
"Peptides LL-37 ([LL-37, 37 aa]), a scrambled LL-37, sLL-37 (RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) and IG-19 (IGKEFKRIVQRIKDFLRNL-NH2) were obtained from CPC Scientific (Sunnyvale, CA). The peptides were re-suspended in endotoxin-free water and stored at −20° until needed."
Huang, Q., Johnson, T.W., Bailey, S., Brooun, A., Bunker, K.D., Burke, B.J., Collins, M.R., Cook, A.S., Cui, J.J., Dack, K.N. and Deal, J.G. Journal of Medicinal Chemistry 57, no. 4 (2014): 1170-1187.
- La Jolla Laboratories, Pfizer Worldwide Research and Development, 10770 Science Center Drive, San Diego, California 92121
The reactions were conducted in 50-μL volumes in 96-well plates and contained 1.3 nM wild-type or 0.5 nM mutant ALK, 3 μM phosphoacceptor peptide (5′FAM-KKSRGDYMTMQIG-CONH2, synthesized by CPC Scientific, Sunnyvale, CA)..
