Skip to content
CPC Scientific LogoCPC Scientific Logo
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • Company
  • News
  • Careers
  • My Account
    • Register
  • Contact Us
  • Services
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    • GMP Peptide ManufacturingHOT
      • Phase I, II, III & Commercial GMP Program OverviewHOT
      • Generic Peptide APIsHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptide Services
    • Research Peptides
      • Custom Services
        • Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
      • FTE ServicesHOT
      • Catalog PeptidesORDER
        • Search
        • Browse Catalog
        • Browse by Catagory
        • Catalog MSDS
        • Terms and Conditions
    • Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
    • Peptide Oligonucleotide Conjugates
      • Peptide Oligonucleotide Conjugates
    • Specialties
      • Project Management
      • Quality & Compliance
  • News & Events
    • Press Releases
    • Events
    • Videos
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Symposium
      • Symposium Overview
      • Scientific Program
      • Speakers
      • Scheduled Events
      • Contact Symposium
  • Knowledge Center
    • White Papers
    • Brochures & Flyers
    • Publications & Citations
      • Search Product Citations
      • Peer-Reviewed Publications
      • GMP Manufacturing Citations
      • Industrial CollaborationsNEW
      • GLP-1 NCE DevelopmentNEW
      • Posters
    • Articles & Insights
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Frequently Asked Questions
    • Glossary
    • MembersPORTAL
    • Browse Knowledge Center
  • About
    • Company Profile
    • Leadership
    • Group History
    • LocationsNEW
    • Careers
  • Quote
    • Quotation Request
    • Frequently Asked Questions
    • Contact Us
  • Cart0
    CPC Scientific LogoCPC Scientific Logo
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Services
          • Modifications
            • Peptide Macrocycles
            • Stapled Peptides
            • Dye Labeled Peptides
            • PEGylated Peptides
            • Click Peptides
            • Glycosylated Peptides
            • Phosphorylated Peptides
            • Peptoids
            • Unnatural Amino Acids
            • Peptide Libraries
            • Lipopeptides
            • Multiple Disulfide Bridges
            • Long Sequences
            • D-Amino Acids
            • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Search
          • Browse Catalog
          • Browse by Catagory
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Quote
      • Quotation Request
      • Frequently Asked Questions
      • Contact Us
    • Cart0
      1. Home
      2. Posts
      3. Antimicrobial Peptides

      Antimicrobial Peptides Archive

      • Human cathelicidin LL-37 and its derivative IG-19 regulate interleukin-32-induced inflammation.

        Choi, Ka-Yee G., Scott Napper, and Neeloffer Mookherjee. Immunology 143.1 (2014): 68-80.

        "Peptides LL-37 ([LL-37, 37 aa]), a scrambled LL-37, sLL-37 (RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) and IG-19 (IGKEFKRIVQRIKDFLRNL-NH2) were obtained from CPC Scientific (Sunnyvale, CA). The peptides were re-suspended in endotoxin-free water and stored at −20° until needed."

        Published On: March 25th, 2014Categories: Antimicrobial Peptides, Citations
        Learn More
      • Critical determinants of human α-defensin 5 activity against non-enveloped viruses.

        Gounder, Anshu P., et al. Journal of Biological Chemistry 287.29 (2012): 24554-24562.

        "..folded HD5 was generated from a synthesized 80% pure linear peptide (CPC Scientific, Sunnyvale, CA) by thiol disulfide reshuffling overnight at room temperature in the presence of 3 mM reduced and 0.3 mM oxidized glutathione, 2 M guanidine hydrochloride, and 0.25 M sodium bicarbonate, pH 8.3, at a peptide concentration of 0.25 mg/ml [..] All α-defensins were quantified by UV absorbance at 280 nm using calculated molar extinction coefficients (18)."

        Published On: May 25th, 2012Categories: Antimicrobial Peptides, Citations, Multiple Disulfide Bridges
        Learn More
      • Scarcity or absence of humoral immune responses in the plasma and cervicovaginal lavage fluids of heavily HIV-1-exposed but persistently seronegative women.

        Mestecky, Jiri, et al. AIDS Research and Human Retroviruses 27.5 (2011): 469-486.

        "The peptides were synthesized as 4-branch MAPS peptides that include a SGGRGG spacer at the C-terminal residue to distance the gp41 sequence from the MAPS (CPC Scientific; San Jose, CA)."

        Published On: May 4th, 2011Categories: Antimicrobial Peptides, Citations
        Learn More
      • Electropositive charge in α-defensin bactericidal activity: functional effects of Lys-for-Arg substitutions vary with the peptide primary structure.

        Llenado, R. Alan, et al. Infection and Immunity 77.11 (2009): 5035-5043.

        "(R/K)-RMAD-4 [rhesus myeloid α-defensin 4] [(R1/2/5/7/10/13/14/26/33K)-RMAD-462-94] was custom synthesized by CPC Scientific, Inc. (San Jose, CA) and refolded as described previously…"

        Published On: October 16th, 2009Categories: Antimicrobial Peptides, Citations, Multiple Disulfide Bridges
        Learn More
      Previous12
      CPC Scientific Inc.

      Our Services

      • GMP Peptide Manufacturing
      • GMP Oligonucleotide Manufacturing
      • Custom Peptide Synthesis
      • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
      • Generic Peptides
      • FTE Services

      Company

      • About Us
      • Group History
      • Press Releases
      • Scheduled Events
      • Careers

      Legal

      • Terms and Conditions
      • Privacy Policy

      Catalog Peptide Orders

      • Shop
      • Orders
      • Shipping Conditions
      • Order FAQs

      Support

      • Knowledge Center
      • Frequently Asked Questions
      • Contact Us

      Follow Us!

      Quotation
      CPC Scientific Inc. is a CRDMO specializing in peptide and oligonucleotide production and therapeutic development.
      We are your TIDES Partner from Concept to Commercial.

      Copyright ©2025 CPC Scientific Inc. | 3880 Atherton Rd, Rocklin, CA 95765, USA | +1 408-734-3800 | All Rights Reserved
      Page load link
      The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy. Accept Reject
      Go to Top