"The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."
Abstract
Tyrosine hydroxylase (TH) catalyzes the rate limiting step in the synthesis of catecholamine neutrotransmitters, and a reduction of TH activity is associated with several neurological diseases. Human TH is regulated, among other mechanisms, by Ser19-phosphorylation-dependent interaction with 14-3-3 proteins. The N-terminal sequence (residues 1-43), which corresponds to an extension to the TH regulatory domain, also interacts with negatively charged membranes. By using X-ray crystallography together with molecular dynamics simulations and structural bioinformatics analysis, we have probed the conformations of the Ser19-phosphorylated N-terminal peptide (THp-(1-43)), bound to 14-3-3γ, free in solution and bound to a phospholipid bilayer, and of the unphosphorylated peptide TH-(1-43) both free and bilayer-bound. As seen in the crystal structure of THp-(1-43) complexed with 14-3-3γ, the region surrounding pSer19 adopts an extended conformation in the bound state, whereas THp-(1-43) adopts a bent conformation when free in solution, with higher content of secondary structure and higher number of internal hydrogen bonds. TH-(1-43) in solution presents the highest mobility and least defined structure of all forms studied, and it shows an energetically more favorable interaction with membranes relative to THp-(1-43). Cationic residues, notably Arg15 and Arg16, which are the recognition sites of the kinases phosphorylating at Ser19, are also contributing to the interaction with the membrane. Our results reveal the structural flexibility of this region of TH, in accordance with the functional versatility and conformational adaptation to different partners. Furthermore, this structural information has potential relevance for the development of therapeutics for neurodegenerative disorders, through modulation of TH-partner interactions.
SOCIAL MEDIA
Connect with us and stay updated by following our social media channels.
Latest Briefings from our Knowledge Center
Press Releases, Industry News, Articles, and Technical Content
Baba, Osamu, Andrew Elvington, Martyna Szpakowska, Deborah Sultan, Gyu Seong Heo, Xiaohui Zhang, Hannah Luehmann et al. bioRxiv (2020).
The FC131 peptide (cyclo[2-Nal-Gly-d-Tyr-NMe-d-Orn-Arg]) was synthesized by CPC Scientific (Sunnyvale, CA).
This guide will help you understand how to read ESI spectra for large and complex bio-molecules like peptides. Other techniques such as high-performance liquid chromatography (HPLC) show one major peak (i.e., absorbance and purity for RP-HPLC) in the spectra, making the interpretation straightforward. ESI-MS spectra are more complicated due to the multiplicity of the data. While most small molecules (100-500 AMU) behave well in ESI-MS and ionize as a single charged state, larger biomolecules, such as peptides, ionize as multiple charged variants. A major advantage of ESI-MS over other mass spectroscopy techniques is that molecular fragmentation is rare (t-Boc groups and a few other protection groups are an exception), which is why ESI-MS is often referred to as a soft ionization technique.
Vickers, Timothy A., Meghdad Rahdar, Thazha P. Prakash, and Stanley T. Crooke. Nucleic Acids Research (2019).
A solution of 1.5 umol SmBiT peptide (Val-Thr-Gly-Tyr-Arg-Leu-Phe-Glu-Glu-Ile-Leu-Gly-Gly-Ser-Gly-Gly-Lys(N3)-NH2) containing an azide group at the C-terminus (CPC Scientific, 1245 Reamwood Ave, Sunnyvale, CA, USA) in DMSO (0.5 ml) was added and the reaction mixture was stirred at room temperature for 5 h.
Solid-phase peptide synthesis (SPPS) has many advantages over liquid-phase peptide synthesis (LPPS) for preparing and manufacturing synthetic peptides. Except the synthesis of short peptide sequences (i.e., less than five amino acid residues), SPPS is faster, more efficient, and more economical than liquid-phase peptide synthesis (LPPS). Some of the advantages of SPPS include: (1) Excess reagents and products can be easily washed away, (2) using excess reagents to increase reaction rates and drive reactions to completion, (3) intermediates do not require isolation or characterization, (4) access to a broader range of solvents with low volatility and high polarity, (5) tethered peptide provides a ‘pseudo-dilute’ microenvironment, which can inhibit intermolecular reactions, making some modifications easier to accomplish, and (6) compatibility with automated synthesis technology.
Lo, J.H., Hao, L., Muzumdar, M.D., Raghavan, S., Kwon, E.J., Pulver, E.M., Hsu, F., Aguirre, A.J., Wolpin, B.M., Fuchs, C.S. and Hahn, W.C. Molecular Cancer Therapeutics 17, no. 11 (2018): 2377-2388.
pTP-TAMRA-iRGD (CH3(CH)15-[GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge]) used in all figures except Fig. S1 was synthesized by CPC Scientific.
Ng, Ee Xien, Myat Noe Hsu, Guoyun Sun, and Chia-Hung Chen. Methods in Enzymology 628 (2019): 59-94.
The peptide sequences of the four FRET-based substrates ([..] CPC Scientific) are as follows: UV: AlexaFluor405-Leu-Ala-Gln-Ala-HompheArg-Ser-Lys (QSY35)-NH2; Blue: Dabcyl-Gly-Pro-Leu-Gly-Met-Arg-Gly-Lys (5-FAM)-NH2; Green: QSY7-Ala-Pro-Phe-Glu..
West, J.A., Tsakmaki, A., Huang, J.H., Ghosh, S.S., Parkes, D.G., Wismann, P., Rigbolt, K.T., Pedersen, P.J., Pavlidis, P., Maggs, D. and Lopez-Talavera, J.C. bioRxiv (2019) 822122.
- Fractyl Laboratories Inc, Lexington, MA, 02421, USA
- Diabetes Research Group, School of Life Course Sciences, Faculty of Life Science and Medicine, King’s College London, London, WC2R 2LS, England, UK
[..] infusion of vehicle 2 via osmotic minipump; (2) glucagon-like peptide-1 receptor (GLP-1R) agonist (0.2 mg/kg liraglutide, SC, QD, Victoza (Novo Nordisk, Bagsværd, Denmark) and continuous infusion of vehicle 2 via osmotic minipump; (3) vehicle 1 (SC, QD) and continuous infusion of a glucose-dependent insulinotropic polypeptide receptor (GIPR) antagonist (∼4.5 mg/kg/day / 56.8 nmol/kg/h GIP[3-30]NH2, CPC Scientific Inc, Sunnyvale, CA, USA) via osmotic minipump;
Artur Javmen, Vladimir Y. Toshchakov, et al. Journal of Leukocyte Biology (2019).
All CPDPs included the N‐terminal Antennapedia homeodomain sequence RQIKIWFQNRRMKWKK.38 The Cy3‐labeled peptides were produced by CPC Scientific (Sunnyvale, CA, USA). The Cy3 label was placed at the peptide N‐terminus..
Gilles, Maud-Emmanuelle, Slack, Frank J, et al. Oncotarget, 2019, Vol. 10, (No. 51), pp: 5349-5358
"Tandem peptide (pTP-iRGD: CH3(CH)15-GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge) was synthesized by CPC Scientific."
