Peptide & Oligo CDMO Services

Research Peptides

CPC Scientific is one of the premier custom peptide producers in the world and we are proud to offer consistently reliable, high-quality peptides directly to researchers.

GMP Peptides

Large-scale manufacturing capacity to support your GMP projects at every stage, from early discovery and late-phase development to full commercialization.

Oligonucleotides

We provide research-grade and clinical-grade oligonucleotide manufacturing services to our clients spanning from discovery to clinical phases.

Peptide-Oligo Conjugates

Our peptide-oligonucleotide conjugate (POC) services seamlessly integrate our peptide and oligonucleotide platforms.

Trusted Peptide & Oligo Manufacturer

With 25 years of expertise, our group is a globally recognized and leading CDMO specializing in peptide and oligonucleotide production. We work directly with leaders in the biotechnology and pharmaceutical industries to help bring life-changing therapeutics and diagnostics to market.

300+

NCE & Generic Projects

13

Commercial GMP Projects

>1T

Annual Production Capacity

Featured News & Articles

Upcoming Events

White Papers

Nothing Found

Recent Publications and Citations

  • Dekker, Petrus Jacobus Theodorus, René Marcel De Jong, and Cornelis Marinus Muijlwijk. U.S. Patent Application No. 14/397,866.

    "The internal standard (ISTD) WIL*GDVFIREYYSV*FDR was ordered from CPC Scientific (Sunnyvale, Calif., USA) and contained L*6×13C 1×15N and V*5×13C 1×15N. The ISTD contained an internal trypsin cleavage site in order to monitor the digestion with trypsin to completion."

    Published On: November 21st, 2017Categories: Citations, Isotope-Labeled Peptides
  • Wuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.

    "LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."

    Published On: November 6th, 2017Categories: Antimicrobial Peptides, Citations
  • Kategaya, L., Di Lello, P., Rougé, L., Pastor, R., Clark, K.R., Drummond, J., Kleinheinz, T., Lin, E., Upton, J.P., Prakash, S. and Heideker, J. Nature 550.7677 (2017): 534.

    1. Departments of Discovery Oncology, Early Discovery Biochemistry, Structural Biology, Discovery Chemistry, Biochemical and Cellular Pharmacology, Protein Chemistry, Microchemistry, Proteomics, and Lipidomics, Research Pathology, Bioinformatics and Computational Biology, and Translational Oncology, Genentech, South San Francisco, 94080, California, USA
    2. Department of Pharmaceutical Chemistry and Small Molecule Discovery Center, University of California, San Francisco, San Francisco, 94143, California, USA
    3. MRC Protein Phosphorylation and Ubiquitylation Unit, School of Life Sciences, University of Dundee, Dundee, DD1 5EH, UK
    4. Institute for Cell and Molecular Biosciences, Newcastle University, Newcastle upon Tyne, NE2 1HH, UK

    "The 5-TAMRA (5-carboxytetramethylrhodamine) peptide was generated by CPCScientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG.."

    Published On: October 26th, 2017Categories: Citations, Dye-Labeled

What Clients Say About Working With CPC Scientific

White Medtide Inc. Logo

Medtide Inc. Stock

Parent Company of CPC Scientific
(HKEX: 3880.HK)

Parent Company of CPC Scientific
(HKEX: 3880.HK)
White Medtide Inc. Logo