Peptide & Oligo CDMO Services
Research Peptides
CPC Scientific is one of the premier custom peptide producers in the world and we are proud to offer consistently reliable, high-quality peptides directly to researchers.
GMP Peptides
Large-scale manufacturing capacity to support your GMP projects at every stage, from early discovery and late-phase development to full commercialization.
Oligonucleotides
We provide research-grade and clinical-grade oligonucleotide manufacturing services to our clients spanning from discovery to clinical phases.
Peptide-Oligo Conjugates
Our peptide-oligonucleotide conjugate (POC) services seamlessly integrate our peptide and oligonucleotide platforms.
Featured News & Articles
Recent Publications and Citations
Dekker, Petrus Jacobus Theodorus, René Marcel De Jong, and Cornelis Marinus Muijlwijk. U.S. Patent Application No. 14/397,866.
"The internal standard (ISTD) WIL*GDVFIREYYSV*FDR was ordered from CPC Scientific (Sunnyvale, Calif., USA) and contained L*6×13C 1×15N and V*5×13C 1×15N. The ISTD contained an internal trypsin cleavage site in order to monitor the digestion with trypsin to completion."
Published On: November 21st, 2017Categories: Citations, Isotope-Labeled PeptidesWuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.
"LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."
Published On: November 6th, 2017Categories: Antimicrobial Peptides, CitationsKategaya, L., Di Lello, P., Rougé, L., Pastor, R., Clark, K.R., Drummond, J., Kleinheinz, T., Lin, E., Upton, J.P., Prakash, S. and Heideker, J. Nature 550.7677 (2017): 534.
- Departments of Discovery Oncology, Early Discovery Biochemistry, Structural Biology, Discovery Chemistry, Biochemical and Cellular Pharmacology, Protein Chemistry, Microchemistry, Proteomics, and Lipidomics, Research Pathology, Bioinformatics and Computational Biology, and Translational Oncology, Genentech, South San Francisco, 94080, California, USA
- Department of Pharmaceutical Chemistry and Small Molecule Discovery Center, University of California, San Francisco, San Francisco, 94143, California, USA
- MRC Protein Phosphorylation and Ubiquitylation Unit, School of Life Sciences, University of Dundee, Dundee, DD1 5EH, UK
- Institute for Cell and Molecular Biosciences, Newcastle University, Newcastle upon Tyne, NE2 1HH, UK
"The 5-TAMRA (5-carboxytetramethylrhodamine) peptide was generated by CPCScientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG.."
Published On: October 26th, 2017Categories: Citations, Dye-Labeled
What Clients Say About Working With CPC Scientific
CPC Scientific has been our trusted provider of high-quality APIs for several years, consistently delivering exceptional reliability, technical expertise, and quality. Their contribution was instrumental in advancing a life-saving therapy. As a European biotech company, we rely on CPC Scientific’s expertise and dedication to support our long-term success.
CEO, Boutique European Biotechnology Company
CPC Scientific has been an essential CDMO partner throughout our peptide development journey, consistently delivering reliable, high-quality peptides. As a small Brazilian biotech focused on specialized disease areas, we value their fairness, transparency, and seamless collaboration. Their support plays a vital role in helping us bring our innovations to life.
Founder & CEO, Mid-Sized Brazilian Biotech Company
CPC Scientific has been an invaluable CRDMO partner in our research. One representative, in particular, has consistently gone above and beyond to ensure our complex peptide orders were delivered on time, ensuring we met key deadlines for PK and efficacy studies. Their exceptional customer service, responsiveness, and industry expertise have made a significant impact on our work. Even as a relatively new client, we’ve felt fully supported. Thank you, CPC Scientific, for your support of academic drug discovery research through outstanding service!
Faculty Member, Drug Discovery Researcher, and Director of R&D, U.S.-Based Academic Institution
CPC Scientific has been our trusted provider of high-quality APIs for several years, consistently delivering exceptional reliability, technical expertise, and quality. Their contribution was instrumental in advancing a life-saving therapy. As a European biotech company, we rely on CPC Scientific’s expertise and dedication to support our long-term success.
CEO, Boutique European Biotechnology Company
CPC Scientific has been an essential CDMO partner throughout our peptide development journey, consistently delivering reliable, high-quality peptides. As a small Brazilian biotech focused on specialized disease areas, we value their fairness, transparency, and seamless collaboration. Their support plays a vital role in helping us bring our innovations to life.
Founder & CEO, Mid-Sized Brazilian Biotech Company
CPC Scientific has been an invaluable CRDMO partner in our research. One representative, in particular, has consistently gone above and beyond to ensure our complex peptide orders were delivered on time, ensuring we met key deadlines for PK and efficacy studies. Their exceptional customer service, responsiveness, and industry expertise have made a significant impact on our work. Even as a relatively new client, we’ve felt fully supported. Thank you, CPC Scientific, for your support of academic drug discovery research through outstanding service!
Faculty Member, Drug Discovery Researcher, and Director of R&D, U.S.-Based Academic Institution
Medtide Inc. Stock
Parent Company of CPC Scientific
(HKEX: 03880)
Parent Company of CPC Scientific
(HKEX: 03880)
