Peptide & Oligo CDMO Services
Research Peptides
CPC Scientific is one of the premier custom peptide producers in the world and we are proud to offer consistently reliable, high-quality peptides directly to researchers.
GMP Peptides
Large-scale manufacturing capacity to support your GMP projects at every stage, from early discovery and late-phase development to full commercialization.
Oligonucleotides
We provide research-grade and clinical-grade oligonucleotide manufacturing services to our clients spanning from discovery to clinical phases.
Peptide-Oligo Conjugates
Our peptide-oligonucleotide conjugate (POC) services seamlessly integrate our peptide and oligonucleotide platforms.
Featured News & Articles
Recent Publications and Citations
Hewings, D.S., Heideker, J., Ma, T.P., AhYoung, A.P., El Oualid, F., Amore, A., Costakes, G.T., Kirchhofer, D., Brasher, B., Pillow, T. and Popovych, N. Nature Communications 9, no. 1 (2018): 1162.
- Discovery Oncology, Genentech, South San Francisco, California, 94080, USA
- Early Discovery Biochemistry, Genentech, South San Francisco, California, 94080, USA
The 5-TAMRA (5-Carboxytetramethylrhodamine) peptide was generated by CPC-Scientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG. K63 or K48 tetra-Ub chains were conjugated to the peptide via its lysine residue [..]
Published On: March 21st, 2018Categories: Citations, Dye-LabeledNuss, Andrew B., and Mark R. Brown. General and Comparative Endocrinology (2017).
"A bioactive form of AaILP3 (norLeu substituted for Met) was synthesized in the laboratory (Brown et al., 2008) and later by CPC Scientific, Inc. (Sunnyvale, CA). [..] stephensi ILP3 and ILP4 (CPC Scientific, Inc.)"
Published On: March 1st, 2018Categories: Citations, Unnatural Amino AcidsNakagawa, Mayumi. U.S. Patent Application 15/552,285, filed February 15, 2018.
“The PepCan peptide mixture will contain four HPV 16 E6 peptides: E6 1-45 (Ac-MHQKRTAMFQDPQER PRKLPQLCTELQTTIHDIILECVYCKQQLL-NH2..), E6 46-80 (Ac-RREVYDFAFRDLCIV YRDGN PYA VCDKCLKFYSKI-NH2..), E6 81-115 (Ac-SEYRHYCYSLYGTTLEQQYNK PLCDLLIRCINCQK-NH2..), and E6 116-158 (Ac-PLCPEEKQRHLDKKQRFHNIRGRWT GRCMSCCRSSRTRRETQL-NH2..) (U.S. Pat. No. 8,652,482). Commercially produced cGMP-grade peptides (CPC Scientific, San Jose, Calif.) will be examined..”
Published On: February 15th, 2018Categories: Citations, GMP Peptide Manufacturing
What Clients Say About Working With CPC Scientific
CPC Scientific has been our trusted provider of high-quality APIs for several years, consistently delivering exceptional reliability, technical expertise, and quality. Their contribution was instrumental in advancing a life-saving therapy. As a European biotech company, we rely on CPC Scientific’s expertise and dedication to support our long-term success.
CEO, Boutique European Biotechnology Company
CPC Scientific has been an essential CDMO partner throughout our peptide development journey, consistently delivering reliable, high-quality peptides. As a small Brazilian biotech focused on specialized disease areas, we value their fairness, transparency, and seamless collaboration. Their support plays a vital role in helping us bring our innovations to life.
Founder & CEO, Mid-Sized Brazilian Biotech Company
CPC Scientific has been an invaluable CRDMO partner in our research. One representative, in particular, has consistently gone above and beyond to ensure our complex peptide orders were delivered on time, ensuring we met key deadlines for PK and efficacy studies. Their exceptional customer service, responsiveness, and industry expertise have made a significant impact on our work. Even as a relatively new client, we’ve felt fully supported. Thank you, CPC Scientific, for your support of academic drug discovery research through outstanding service!
Faculty Member, Drug Discovery Researcher, and Director of R&D, U.S.-Based Academic Institution
CPC Scientific has been our trusted provider of high-quality APIs for several years, consistently delivering exceptional reliability, technical expertise, and quality. Their contribution was instrumental in advancing a life-saving therapy. As a European biotech company, we rely on CPC Scientific’s expertise and dedication to support our long-term success.
CEO, Boutique European Biotechnology Company
CPC Scientific has been an essential CDMO partner throughout our peptide development journey, consistently delivering reliable, high-quality peptides. As a small Brazilian biotech focused on specialized disease areas, we value their fairness, transparency, and seamless collaboration. Their support plays a vital role in helping us bring our innovations to life.
Founder & CEO, Mid-Sized Brazilian Biotech Company
CPC Scientific has been an invaluable CRDMO partner in our research. One representative, in particular, has consistently gone above and beyond to ensure our complex peptide orders were delivered on time, ensuring we met key deadlines for PK and efficacy studies. Their exceptional customer service, responsiveness, and industry expertise have made a significant impact on our work. Even as a relatively new client, we’ve felt fully supported. Thank you, CPC Scientific, for your support of academic drug discovery research through outstanding service!
Faculty Member, Drug Discovery Researcher, and Director of R&D, U.S.-Based Academic Institution
Medtide Inc. Stock
Parent Company of CPC Scientific
(HKEX: 03880)
Parent Company of CPC Scientific
(HKEX: 03880)
