Fu, Shushu, et al. Microbes and Infection 17.9 (2015): 665-670.
"The peptides P20A (Ac-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH 2 ) and biotin-P20A (biotin-PEG4-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH2 ) were synthesized by CPC Scientific."
Oliveira, E. A., and B. L. Faintuch. Nuclear Medicine and Biology 42.2 (2015): 123-130.
"...4 -c(GX1) 774.9 μM or HYNIC-E-[c(RGDfk)-c(GX1)] 569.5 μM (μg/mL) (CPC Scientific Inc., CA ... 5 /well) were seeded into well culture plates, and it was added the radiotracers 99m Tc-HYNIC-PEG 4 -c ... For nonspecific binding assays, cold conjugate (1 mmol/L/well) was also ..."
Warren, Andrew D., et al. Journal of the American Chemical Society 136.39 (2014): 13709-13714.
"Thrombin-sensitive reporter 1 (R1) was synthesized by CPC Scientific, with the sequence Biotin-PEG5kDa-Lys(5FAM)-Gly-Gly-DPhe-Pro-Arg-Ser-Gly-Gly-Gly-Cys, where PEG5kDa is 5 kDa poly(ethylene glycol)."
Yu, Yang, et al. Science China Life Sciences 57.1 (2014): 117-127.
"The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."
Dvir, Hay, et al. Proceedings of the National Academy of Sciences 109.18 (2012): 6916-6921.
"The biotinylated synthetic LDLR peptide [Biotin-PEG8-SINFDNPVYQKT (CPC Scientific)] was captured to ≈20–50 RU, whereas ≈200 RU of the J.D. mutant peptide (Biotin-PEG8-SINFDNPVCQKT) was required for proper detection of ARH binding."
