Skip to content
CPC Scientific LogoCPC Scientific Logo
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • Company
  • News
  • Careers
  • My Account
    • Register
  • Contact Us
  • Services
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    • GMP Peptide ManufacturingHOT
      • Phase I, II, III & Commercial GMP Program OverviewHOT
      • Generic Peptide APIsHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptide Services
    • Research Peptides
      • Custom Services
        • Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
      • FTE ServicesHOT
      • Catalog PeptidesORDER
        • Search
        • Browse Catalog
        • Browse by Catagory
        • Catalog MSDS
        • Terms and Conditions
    • Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
    • Peptide Oligonucleotide Conjugates
      • Peptide Oligonucleotide Conjugates
    • Specialties
      • Project Management
      • Quality & Compliance
  • News & Events
    • Press Releases
    • Events
    • Videos
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Symposium
      • Symposium Overview
      • Scientific Program
      • Speakers
      • Scheduled Events
      • Contact Symposium
  • Knowledge Center
    • White Papers
    • Brochures & Flyers
    • Publications & Citations
      • Search Product Citations
      • Peer-Reviewed Publications
      • GMP Manufacturing Citations
      • Industrial CollaborationsNEW
      • GLP-1 NCE DevelopmentNEW
      • Posters
    • Articles & Insights
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Frequently Asked Questions
    • Glossary
    • MembersPORTAL
    • Browse Knowledge Center
  • About
    • Company Profile
    • Leadership
    • Group History
    • LocationsNEW
    • Careers
  • Quote
    • Quotation Request
    • Frequently Asked Questions
    • Contact Us
  • Cart0
    CPC Scientific LogoCPC Scientific Logo
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Services
          • Modifications
            • Peptide Macrocycles
            • Stapled Peptides
            • Dye Labeled Peptides
            • PEGylated Peptides
            • Click Peptides
            • Glycosylated Peptides
            • Phosphorylated Peptides
            • Peptoids
            • Unnatural Amino Acids
            • Peptide Libraries
            • Lipopeptides
            • Multiple Disulfide Bridges
            • Long Sequences
            • D-Amino Acids
            • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Search
          • Browse Catalog
          • Browse by Catagory
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Quote
      • Quotation Request
      • Frequently Asked Questions
      • Contact Us
    • Cart0
      1. Home
      2. Posts
      3. PEGylation

      PEGylation Archive

      • P20A inhibits HIV-1 fusion through its electrostatic interaction with the distal region of the gp41 fusion core.

        Fu, Shushu, et al. Microbes and Infection 17.9 (2015): 665-670.

        "The peptides P20A (Ac-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH 2 ) and biotin-P20A (biotin-PEG4-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH2 ) were synthesized by CPC Scientific."

        Published On: September 1st, 2015Categories: Citations, PEGylation
        Learn More
      • Radiolabeling and biological evaluation of the GX1 and RGD-GX1 peptide sequence for angiogenesis targeting.

        Oliveira, E. A., and B. L. Faintuch. Nuclear Medicine and Biology 42.2 (2015): 123-130.

        "...4 -c(GX1) 774.9 μM or HYNIC-E-[c(RGDfk)-c(GX1)] 569.5 μM (μg/mL) (CPC Scientific Inc., CA ... 5 /well) were seeded into well culture plates, and it was added the radiotracers 99m Tc-HYNIC-PEG 4 -c ... For nonspecific binding assays, cold conjugate (1 mmol/L/well) was also ..."

        Published On: September 28th, 2014Categories: Citations, Metal Chelates, PEGylation, Peptide Macrocycles
        Learn More
      • Disease detection by ultrasensitive quantification of microdosed synthetic urinary biomarkers.

        Warren, Andrew D., et al. Journal of the American Chemical Society 136.39 (2014): 13709-13714.

        "Thrombin-sensitive reporter 1 (R1) was synthesized by CPC Scientific, with the sequence Biotin-PEG5kDa-Lys(5FAM)-Gly-Gly-DPhe-Pro-Arg-Ser-Gly-Gly-Gly-Cys, where PEG5kDa is 5 kDa poly(ethylene glycol)."

        Published On: September 8th, 2014Categories: Citations, Dye-Labeled, PEGylation, Showcase Dye-Labeled
        Learn More
      • 10E8-like neutralizing antibodies against HIV-1 induced using a precisely designed conformational peptide as a vaccine prime.

        Yu, Yang, et al. Science China Life Sciences 57.1 (2014): 117-127.

        "The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."

        Published On: December 26th, 2013Categories: Citations, PEGylation
        Learn More
      • Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail.

        Dvir, Hay, et al. Proceedings of the National Academy of Sciences 109.18 (2012): 6916-6921.

        "The biotinylated synthetic LDLR peptide [Biotin-PEG8-SINFDNPVYQKT (CPC Scientific)] was captured to ≈20–50 RU, whereas ≈200 RU of the J.D. mutant peptide (Biotin-PEG8-SINFDNPVCQKT) was required for proper detection of ARH binding."

        Published On: May 1st, 2012Categories: Citations, PEGylation, Showcase PEGylation
        Learn More
      Previous23
      CPC Scientific Inc.

      Our Services

      • GMP Peptide Manufacturing
      • GMP Oligonucleotide Manufacturing
      • Custom Peptide Synthesis
      • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
      • Generic Peptides
      • FTE Services

      Company

      • About Us
      • Group History
      • Press Releases
      • Scheduled Events
      • Careers

      Legal

      • Terms and Conditions
      • Privacy Policy

      Catalog Peptide Orders

      • Shop
      • Orders
      • Shipping Conditions
      • Order FAQs

      Support

      • Knowledge Center
      • Frequently Asked Questions
      • Contact Us

      Follow Us!

      Quotation
      CPC Scientific Inc. is a CRDMO specializing in peptide and oligonucleotide production and therapeutic development.
      We are your TIDES Partner from Concept to Commercial.

      Copyright ©2025 CPC Scientific Inc. | 3880 Atherton Rd, Rocklin, CA 95765, USA | +1 408-734-3800 | All Rights Reserved
      Page load link
      The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy. Accept Reject
      Go to Top