Skip to content
  • Medtide Inc.
  • CPC Scientific Inc.
  • Company
  • Careers
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • My Account
    • Register
  • Cart0
    CPC Scientific

    A subsidiary of
    Medtide Inc.
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Peptide Synthesis
        • Custom Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Browse Catalog
          • Browse by Category
          • Search
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide–Oligo Conjugate Services
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Contact
    • Quote
      • Quotation Request
      • Frequently Asked Questions
    • Medtide Inc.
    • CPC Scientific Inc.

    CPC Scientific

    A subsidiary of
    Medtide Inc.
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Peptide Synthesis
        • Custom Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Browse Catalog
          • Browse by Category
          • Search
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide–Oligo Conjugate Services
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Contact
    • Quote
      • Quotation Request
      • Frequently Asked Questions
    1. Home
    2. Posts
    3. PEGylation

    PEGylation Archive

    • P20A inhibits HIV-1 fusion through its electrostatic interaction with the distal region of the gp41 fusion core.

      Fu, Shushu, et al. Microbes and Infection 17.9 (2015): 665-670.

      "The peptides P20A (Ac-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH 2 ) and biotin-P20A (biotin-PEG4-AAASGINAEWPLWPGEAGWGRLEGRRTYEAEI-NH2 ) were synthesized by CPC Scientific."

      Published On: September 1st, 2015Categories: Citations, PEGylation
      Learn More
    • Radiolabeling and biological evaluation of the GX1 and RGD-GX1 peptide sequence for angiogenesis targeting.

      Oliveira, E. A., and B. L. Faintuch. Nuclear Medicine and Biology 42.2 (2015): 123-130.

      "...4 -c(GX1) 774.9 μM or HYNIC-E-[c(RGDfk)-c(GX1)] 569.5 μM (μg/mL) (CPC Scientific Inc., CA ... 5 /well) were seeded into well culture plates, and it was added the radiotracers 99m Tc-HYNIC-PEG 4 -c ... For nonspecific binding assays, cold conjugate (1 mmol/L/well) was also ..."

      Published On: September 28th, 2014Categories: Citations, Metal Chelates, PEGylation, Peptide Macrocycles
      Learn More
    • Disease detection by ultrasensitive quantification of microdosed synthetic urinary biomarkers.

      Warren, Andrew D., et al. Journal of the American Chemical Society 136.39 (2014): 13709-13714.

      "Thrombin-sensitive reporter 1 (R1) was synthesized by CPC Scientific, with the sequence Biotin-PEG5kDa-Lys(5FAM)-Gly-Gly-DPhe-Pro-Arg-Ser-Gly-Gly-Gly-Cys, where PEG5kDa is 5 kDa poly(ethylene glycol)."

      Published On: September 8th, 2014Categories: Citations, Dye-Labeled, PEGylation, Showcase Dye-Labeled
      Learn More
    • 10E8-like neutralizing antibodies against HIV-1 induced using a precisely designed conformational peptide as a vaccine prime.

      Yu, Yang, et al. Science China Life Sciences 57.1 (2014): 117-127.

      "The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."

      Published On: December 26th, 2013Categories: Citations, PEGylation
      Learn More
    • Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail.

      Dvir, Hay, et al. Proceedings of the National Academy of Sciences 109.18 (2012): 6916-6921.

      "The biotinylated synthetic LDLR peptide [Biotin-PEG8-SINFDNPVYQKT (CPC Scientific)] was captured to ≈20–50 RU, whereas ≈200 RU of the J.D. mutant peptide (Biotin-PEG8-SINFDNPVCQKT) was required for proper detection of ARH binding."

      Published On: May 1st, 2012Categories: Citations, PEGylation, Showcase PEGylation
      Learn More
    Previous23
    CPC Scientific Logo Tides Partner and Peptide Manufacturer

    Our Manufacturing Services

    GMP Peptide Manufacturing
    GMP Oligonucleotide Manufacturing
    Custom Peptide Synthesis
    Oligonucleotide Services
    Peptide–Oligonucleotide Conjugates
    Generic Peptides
    FTE Services
    • GMP Peptide Manufacturing
    • GMP Oligonucleotide Manufacturing
    • Custom Peptide Synthesis
    • Oligonucleotide Services
    • Peptide Oligonucleotide ConjugatesNEW
    • Generic Peptides
    • FTE Services

    Resources & Support

    • Knowledge Center
    • Frequently Asked Questions
    • Contact Us

    Company

    • About Us
    • Group History
    • Press Releases
    • Scheduled Events
    • Careers

    Catalog Peptide Orders

    • Shop
    • Orders
    • Shipping Conditions
    • Order FAQs

    Get in Touch

    • Contact Us
    • Request Quotation
    • Subscribe to Newsletter
    sales@cpcscientific.com
    +1 (408) 734-3800
    sales@cpcscientific.com
    +1 (408) 734-3800

    Copyright © 2026 CPC Scientific Inc. All Rights Reserved.

    • Terms and Conditions
    • Privacy Policy
    Page load link
    The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy.
    Accept Reject
    Go to Top