Peptide & Oligo CDMO Services
Research Peptides
CPC Scientific is one of the premier custom peptide producers in the world and we are proud to offer consistently reliable, high-quality peptides directly to researchers.
GMP Peptides
Large-scale manufacturing capacity to support your GMP projects at every stage, from early discovery and late-phase development to full commercialization.
Oligonucleotides
We provide research-grade and clinical-grade oligonucleotide manufacturing services to our clients spanning from discovery to clinical phases.
Peptide-Oligo Conjugates
Our peptide-oligonucleotide conjugate (POC) services seamlessly integrate our peptide and oligonucleotide platforms.
Trusted Peptide & Oligo Manufacturer
With 25 years of expertise, our group is a globally recognized and leading CDMO specializing in peptide and oligonucleotide production. We work directly with leaders in the biotechnology and pharmaceutical industries to help bring life-changing therapeutics and diagnostics to market.
300+
NCE & Generic Projects
13
Commercial GMP Projects
>1T
Annual Production Capacity
Featured News & Articles
Recent Publications and Citations
Harper, Brett, Mahsan Miladi, and Touradj Solouki. Journal of The American Society for Mass Spectrometry 25.10 (2014): 1716-1729.
"antipeptide (EGVYVHPV), angiotensin II, human (DRVYIHPF), and isotopically (13C) labeled heptapeptide (AAAAHAA-NH2 [where “A” indicates a carbon thirteen (13C) isotope on the alanine carbonyl group]) were purchased from CPC Scientific Incorporated (Sunnyvale, CA)"
Published On: July 29th, 2014Categories: Citations, Isotope-Labeled PeptidesChoi, Ka-Yee G., Scott Napper, and Neeloffer Mookherjee. Immunology 143.1 (2014): 68-80.
"Peptides LL-37 ([LL-37, 37 aa]), a scrambled LL-37, sLL-37 (RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) and IG-19 (IGKEFKRIVQRIKDFLRNL-NH2) were obtained from CPC Scientific (Sunnyvale, CA). The peptides were re-suspended in endotoxin-free water and stored at −20° until needed."
Published On: March 25th, 2014Categories: Antimicrobial Peptides, CitationsHuang, Q., Johnson, T.W., Bailey, S., Brooun, A., Bunker, K.D., Burke, B.J., Collins, M.R., Cook, A.S., Cui, J.J., Dack, K.N. and Deal, J.G. Journal of Medicinal Chemistry 57, no. 4 (2014): 1170-1187.
- La Jolla Laboratories, Pfizer Worldwide Research and Development, 10770 Science Center Drive, San Diego, California 92121
The reactions were conducted in 50-μL volumes in 96-well plates and contained 1.3 nM wild-type or 0.5 nM mutant ALK, 3 μM phosphoacceptor peptide (5′FAM-KKSRGDYMTMQIG-CONH2, synthesized by CPC Scientific, Sunnyvale, CA)..
Published On: January 16th, 2014Categories: Citations, Dye-Labeled
What Clients Say About Working With CPC Scientific
CPC Scientific has been our trusted provider of high-quality APIs for several years, consistently delivering exceptional reliability, technical expertise, and quality. Their contribution was instrumental in advancing a life-saving therapy. As a European biotech company, we rely on CPC Scientific’s expertise and dedication to support our long-term success.
CEO, Boutique European Biotechnology Company
CPC Scientific has been an essential CDMO partner throughout our peptide development journey, consistently delivering reliable, high-quality peptides. As a small Brazilian biotech focused on specialized disease areas, we value their fairness, transparency, and seamless collaboration. Their support plays a vital role in helping us bring our innovations to life.
Founder & CEO, Mid-Sized Brazilian Biotech Company
CPC Scientific has been an invaluable CRDMO partner in our research. One representative, in particular, has consistently gone above and beyond to ensure our complex peptide orders were delivered on time, ensuring we met key deadlines for PK and efficacy studies. Their exceptional customer service, responsiveness, and industry expertise have made a significant impact on our work. Even as a relatively new client, we’ve felt fully supported. Thank you, CPC Scientific, for your support of academic drug discovery research through outstanding service!
Faculty Member, Drug Discovery Researcher, and Director of R&D, U.S.-Based Academic Institution
CPC Scientific has been our trusted provider of high-quality APIs for several years, consistently delivering exceptional reliability, technical expertise, and quality. Their contribution was instrumental in advancing a life-saving therapy. As a European biotech company, we rely on CPC Scientific’s expertise and dedication to support our long-term success.
CEO, Boutique European Biotechnology Company
CPC Scientific has been an essential CDMO partner throughout our peptide development journey, consistently delivering reliable, high-quality peptides. As a small Brazilian biotech focused on specialized disease areas, we value their fairness, transparency, and seamless collaboration. Their support plays a vital role in helping us bring our innovations to life.
Founder & CEO, Mid-Sized Brazilian Biotech Company
CPC Scientific has been an invaluable CRDMO partner in our research. One representative, in particular, has consistently gone above and beyond to ensure our complex peptide orders were delivered on time, ensuring we met key deadlines for PK and efficacy studies. Their exceptional customer service, responsiveness, and industry expertise have made a significant impact on our work. Even as a relatively new client, we’ve felt fully supported. Thank you, CPC Scientific, for your support of academic drug discovery research through outstanding service!
Faculty Member, Drug Discovery Researcher, and Director of R&D, U.S.-Based Academic Institution
Medtide Inc. Stock
Parent Company of CPC Scientific
(HKEX: 3880.HK)


