Skip to content
CPC Scientific LogoCPC Scientific Logo
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • Company
  • News
  • Careers
  • My Account
    • Register
  • Contact Us
  • Services
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    • GMP Peptide ManufacturingHOT
      • Phase I, II, III & Commercial GMP Program OverviewHOT
      • Generic Peptide APIsHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptide Services
    • Research Peptides
      • Custom Services
        • Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
      • FTE ServicesHOT
      • Catalog PeptidesORDER
        • Search
        • Browse Catalog
        • Browse by Catagory
        • Catalog MSDS
        • Terms and Conditions
    • Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
    • Peptide Oligonucleotide Conjugates
      • Peptide Oligonucleotide Conjugates
    • Specialties
      • Project Management
      • Quality & Compliance
  • News & Events
    • Press Releases
    • Events
    • Videos
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Symposium
      • Symposium Overview
      • Scientific Program
      • Speakers
      • Scheduled Events
      • Contact Symposium
  • Knowledge Center
    • White Papers
    • Brochures & Flyers
    • Publications & Citations
      • Search Product Citations
      • Peer-Reviewed Publications
      • GMP Manufacturing Citations
      • Industrial CollaborationsNEW
      • GLP-1 NCE DevelopmentNEW
      • Posters
    • Articles & Insights
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Frequently Asked Questions
    • Glossary
    • MembersPORTAL
    • Browse Knowledge Center
  • About
    • Company Profile
    • Leadership
    • Group History
    • LocationsNEW
    • Careers
  • Quote
    • Quotation Request
    • Frequently Asked Questions
    • Contact Us
  • Cart0
    CPC Scientific LogoCPC Scientific Logo
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Services
          • Modifications
            • Peptide Macrocycles
            • Stapled Peptides
            • Dye Labeled Peptides
            • PEGylated Peptides
            • Click Peptides
            • Glycosylated Peptides
            • Phosphorylated Peptides
            • Peptoids
            • Unnatural Amino Acids
            • Peptide Libraries
            • Lipopeptides
            • Multiple Disulfide Bridges
            • Long Sequences
            • D-Amino Acids
            • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Search
          • Browse Catalog
          • Browse by Catagory
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Quote
      • Quotation Request
      • Frequently Asked Questions
      • Contact Us
    • Cart0
      1. Home
      2. Posts
      3. Citations

      Citations Archive

      • Discovery and characterization of a small‐molecule enteropeptidase inhibitor, SCO‐792.

        Sasaki, Masako, Ken‐ichi Hamagami et al. Pharmacology Research & Perspectives 7, no. 5 (2019): e00517.

        • Research, Takeda Pharmaceutical Company Limited, Fujisawa, Kanagawa, Japan

        The substrates QSY21‐Gly‐Asp‐Asp‐Asp‐Lys‐Ile‐Val‐Gly‐Gly‐Lys(Cy5) and 5FAM‐Abu‐Gly‐Asp‐Asp‐Asp‐Lys‐Ile‐Val‐Gly‐Gly‐Lys(CPQ2)‐Lys‐Lys‐NH2 were purchased from CPC Scientific (Sunnyvale, CA).

        Published On: February 7th, 2019Categories: Citations, Dye-Labeled, FRET Substrates
        Learn More
      • In vitro reconstitution of Wnt acylation reveals structural determinants of substrate recognition by the acyltransferase human Porcupine.

        Lee, Chul-Jin, Mitra S. Rana, Chanhyung Bae, Yan Li, and Anirban Banerjee. Journal of Biological Chemistry 294, no. 1 (2019): 231-245.

        Substrate-mimicking peptides for wild-type or mutant Wnts with a point-mutation, varying in lengths or the number of disulfide bonds were purchased from CPC Scientific (Sunnyvale, CA)..

        Published On: November 12th, 2018Categories: Citations, Multiple Disulfide Bridges
        Learn More
      • Extended intravitreal rabbit eye residence of nanoparticles conjugated with cationic arginine peptides for intraocular drug delivery: in vivo imaging.

        Melgar-Asensio, Ignacio, et al. Investigative Ophthalmology & Visual Science 59.10 (2018): 4071-4081.

        Thio-peptide: NH2-Cys-PEG4-Sar-YNLYRVRS-NH2, MW 1,490 g/mol was custom synthesized, via solid state methods by CPC Scientific (Sunnyvale, CA, USA).

        Published On: August 1st, 2018Categories: Citations, PEGylation, Unnatural Amino Acids
        Learn More
      • A GLP-1:CCK fusion peptide harnesses the synergistic effects on metabolism of CCK-1 and GLP-1 receptor agonism in mice

        Hornigold, D.C., Roth, E., Howard, V., Will, S., Oldham, S., Coghlan, M.P., Blouet, C. and Trevaskis, J.L. Appetite 127 (2018): 334-340.

        1. Cardiovascular and Metabolic Diseases, MedImmune Ltd, Milstein Building, Granta Park, Cambridge, CB21 6GH, UK
        2. University of Cambridge, Department of Clinical Biochemistry, MRC Metabolic Diseases Unit, Addenbrooke's Hospital, Cambridge, CB2 0QQ, UK
        3. Cardiovascular and Metabolic Diseases, MedImmune LLC, One MedImmune Way, Gaithersburg, MD 20878, USA

        AC3174 (Amylin Pharmaceuticals) is a functional analog of exenatide (Hargrove et al., 2007). AC170222 (Hpa-Nle-Gly-Trp-Lys(Tac)-Asp-NMePhe-NH2; CPC Scientific, Sunnyvale, CA) is a CCKR1-selective peptide (Pierson et al., 2000).

        Published On: May 19th, 2018Categories: Citations, Unnatural Amino Acids
        Learn More
      • Reactive-site-centric chemoproteomics identifies a distinct class of deubiquitinase enzymes.

        Hewings, D.S., Heideker, J., Ma, T.P., AhYoung, A.P., El Oualid, F., Amore, A., Costakes, G.T., Kirchhofer, D., Brasher, B., Pillow, T. and Popovych, N. Nature Communications 9, no. 1 (2018): 1162.

        • Discovery Oncology, Genentech, South San Francisco, California, 94080, USA
        • Early Discovery Biochemistry, Genentech, South San Francisco, California, 94080, USA

        The 5-TAMRA (5-Carboxytetramethylrhodamine) peptide was generated by CPC-Scientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG. K63 or K48 tetra-Ub chains were conjugated to the peptide via its lysine residue [..]

        Published On: March 21st, 2018Categories: Citations, Dye-Labeled
        Learn More
      • IIsolation of an insulin-like peptide from the Asian malaria mosquito, Anopheles stephensi, that acts as a steroidogenic gonadotropin across diverse mosquito taxa.

        Nuss, Andrew B., and Mark R. Brown. General and Comparative Endocrinology (2017).

        "A bioactive form of AaILP3 (norLeu substituted for Met) was synthesized in the laboratory (Brown et al., 2008) and later by CPC Scientific, Inc. (Sunnyvale, CA). [..] stephensi ILP3 and ILP4 (CPC Scientific, Inc.)"

        Published On: March 1st, 2018Categories: Citations, Unnatural Amino Acids
        Learn More
      • Recall antigen for promoting T-helper type 1 response.

        Nakagawa, Mayumi. U.S. Patent Application 15/552,285, filed February 15, 2018.

        “The PepCan peptide mixture will contain four HPV 16 E6 peptides: E6 1-45 (Ac-MHQKRTAMFQDPQER PRKLPQLCTELQTTIHDIILECVYCKQQLL-NH2..), E6 46-80 (Ac-RREVYDFAFRDLCIV YRDGN PYA VCDKCLKFYSKI-NH2..), E6 81-115 (Ac-SEYRHYCYSLYGTTLEQQYNK PLCDLLIRCINCQK-NH2..), and E6 116-158 (Ac-PLCPEEKQRHLDKKQRFHNIRGRWT GRCMSCCRSSRTRRETQL-NH2..) (U.S. Pat. No. 8,652,482). Commercially produced cGMP-grade peptides (CPC Scientific, San Jose, Calif.) will be examined..”

        Published On: February 15th, 2018Categories: Citations, GMP Peptide Manufacturing
        Learn More
      • Chymosine enzyme variants.

        Dekker, Petrus Jacobus Theodorus, René Marcel De Jong, and Cornelis Marinus Muijlwijk. U.S. Patent Application No. 14/397,866.

        "The internal standard (ISTD) WIL*GDVFIREYYSV*FDR was ordered from CPC Scientific (Sunnyvale, Calif., USA) and contained L*6×13C 1×15N and V*5×13C 1×15N. The ISTD contained an internal trypsin cleavage site in order to monitor the digestion with trypsin to completion."

        Published On: November 21st, 2017Categories: Citations, Isotope-Labeled Peptides
        Learn More
      • Synthetic host defense peptide IDR-1002 reduces inflammation in Pseudomonas aeruginosa lung infection.

        Wuerth, Kelli C., Reza Falsafi, and Robert EW Hancock. PloS One 12, no. 11 (2017): e0187565.

        "LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2) was purchased from CPC Scientific (Sunnyvale, California, USA).."

        Published On: November 6th, 2017Categories: Antimicrobial Peptides, Citations
        Learn More
      • USP7 small-molecule inhibitors interfere with ubiquitin binding.

        Kategaya, L., Di Lello, P., Rougé, L., Pastor, R., Clark, K.R., Drummond, J., Kleinheinz, T., Lin, E., Upton, J.P., Prakash, S. and Heideker, J. Nature 550.7677 (2017): 534.

        1. Departments of Discovery Oncology, Early Discovery Biochemistry, Structural Biology, Discovery Chemistry, Biochemical and Cellular Pharmacology, Protein Chemistry, Microchemistry, Proteomics, and Lipidomics, Research Pathology, Bioinformatics and Computational Biology, and Translational Oncology, Genentech, South San Francisco, 94080, California, USA
        2. Department of Pharmaceutical Chemistry and Small Molecule Discovery Center, University of California, San Francisco, San Francisco, 94143, California, USA
        3. MRC Protein Phosphorylation and Ubiquitylation Unit, School of Life Sciences, University of Dundee, Dundee, DD1 5EH, UK
        4. Institute for Cell and Molecular Biosciences, Newcastle University, Newcastle upon Tyne, NE2 1HH, UK

        "The 5-TAMRA (5-carboxytetramethylrhodamine) peptide was generated by CPCScientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG.."

        Published On: October 26th, 2017Categories: Citations, Dye-Labeled
        Learn More
      Previous8910Next
      CPC Scientific Inc.

      Our Services

      • GMP Peptide Manufacturing
      • GMP Oligonucleotide Manufacturing
      • Custom Peptide Synthesis
      • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
      • Generic Peptides
      • FTE Services

      Company

      • About Us
      • Group History
      • Press Releases
      • Scheduled Events
      • Careers

      Legal

      • Terms and Conditions
      • Privacy Policy

      Catalog Peptide Orders

      • Shop
      • Orders
      • Shipping Conditions
      • Order FAQs

      Support

      • Knowledge Center
      • Frequently Asked Questions
      • Contact Us

      Follow Us!

      Quotation
      CPC Scientific Inc. is a CRDMO specializing in peptide and oligonucleotide production and therapeutic development.
      We are your TIDES Partner from Concept to Commercial.

      Copyright ©2025 CPC Scientific Inc. | 3880 Atherton Rd, Rocklin, CA 95765, USA | +1 408-734-3800 | All Rights Reserved
      Page load link
      The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy. Accept Reject
      Go to Top