"The tandem peptide library used in this work was synthesized via standard FMOC solid-phase peptide synthesis and purified by high-performance liquid chromatography at the MIT Biopolymers Core, Tufts University Core Facility or CPC Scientific, Inc."
Abstract
Aspects of the invention provide compositions and methods for delivering nucleic acids to target cells.
Latest Briefings from our Knowledge Center
Press Releases, Industry News, Articles, and Technical Content
Sasaki, Masako, Ken‐ichi Hamagami et al. Pharmacology Research & Perspectives 7, no. 5 (2019): e00517.
- Research, Takeda Pharmaceutical Company Limited, Fujisawa, Kanagawa, Japan
The substrates QSY21‐Gly‐Asp‐Asp‐Asp‐Lys‐Ile‐Val‐Gly‐Gly‐Lys(Cy5) and 5FAM‐Abu‐Gly‐Asp‐Asp‐Asp‐Lys‐Ile‐Val‐Gly‐Gly‐Lys(CPQ2)‐Lys‐Lys‐NH2 were purchased from CPC Scientific (Sunnyvale, CA).
February 7th, 2019Citations, Dye-Labeled, FRET SubstratesThis year, “The 7th CPC Symposium on Peptide Therapeutics” will continue the tradition of the successful conferences from previous years. The meeting will offer a forum for scientific discussions of recent developments in the exciting field of peptide therapeutics. It will feature lectures on a broad range of topics including new technologies, drug discovery, CMC, […]
January 25th, 2019Press ReleasesLee, Chul-Jin, Mitra S. Rana, Chanhyung Bae, Yan Li, and Anirban Banerjee. Journal of Biological Chemistry 294, no. 1 (2019): 231-245.
Substrate-mimicking peptides for wild-type or mutant Wnts with a point-mutation, varying in lengths or the number of disulfide bonds were purchased from CPC Scientific (Sunnyvale, CA)..
November 12th, 2018Citations, Multiple Disulfide BridgesMelgar-Asensio, Ignacio, et al. Investigative Ophthalmology & Visual Science 59.10 (2018): 4071-4081.
Thio-peptide: NH2-Cys-PEG4-Sar-YNLYRVRS-NH2, MW 1,490 g/mol was custom synthesized, via solid state methods by CPC Scientific (Sunnyvale, CA, USA).
August 1st, 2018Citations, PEGylation, Unnatural Amino AcidsHornigold, D.C., Roth, E., Howard, V., Will, S., Oldham, S., Coghlan, M.P., Blouet, C. and Trevaskis, J.L. Appetite 127 (2018): 334-340.
- Cardiovascular and Metabolic Diseases, MedImmune Ltd, Milstein Building, Granta Park, Cambridge, CB21 6GH, UK
- University of Cambridge, Department of Clinical Biochemistry, MRC Metabolic Diseases Unit, Addenbrooke's Hospital, Cambridge, CB2 0QQ, UK
- Cardiovascular and Metabolic Diseases, MedImmune LLC, One MedImmune Way, Gaithersburg, MD 20878, USA
AC3174 (Amylin Pharmaceuticals) is a functional analog of exenatide (Hargrove et al., 2007). AC170222 (Hpa-Nle-Gly-Trp-Lys(Tac)-Asp-NMePhe-NH2; CPC Scientific, Sunnyvale, CA) is a CCKR1-selective peptide (Pierson et al., 2000).
May 19th, 2018Citations, Unnatural Amino AcidsHewings, D.S., Heideker, J., Ma, T.P., AhYoung, A.P., El Oualid, F., Amore, A., Costakes, G.T., Kirchhofer, D., Brasher, B., Pillow, T. and Popovych, N. Nature Communications 9, no. 1 (2018): 1162.
- Discovery Oncology, Genentech, South San Francisco, California, 94080, USA
- Early Discovery Biochemistry, Genentech, South San Francisco, California, 94080, USA
The 5-TAMRA (5-Carboxytetramethylrhodamine) peptide was generated by CPC-Scientific consisting of the sequence 5-TAMRA-YPYDVPDYAIREIVSRNKRRYQEDG. K63 or K48 tetra-Ub chains were conjugated to the peptide via its lysine residue [..]
March 21st, 2018Citations, Dye-LabeledNuss, Andrew B., and Mark R. Brown. General and Comparative Endocrinology (2017).
"A bioactive form of AaILP3 (norLeu substituted for Met) was synthesized in the laboratory (Brown et al., 2008) and later by CPC Scientific, Inc. (Sunnyvale, CA). [..] stephensi ILP3 and ILP4 (CPC Scientific, Inc.)"
March 1st, 2018Citations, Unnatural Amino AcidsNakagawa, Mayumi. U.S. Patent Application 15/552,285, filed February 15, 2018.
“The PepCan peptide mixture will contain four HPV 16 E6 peptides: E6 1-45 (Ac-MHQKRTAMFQDPQER PRKLPQLCTELQTTIHDIILECVYCKQQLL-NH2..), E6 46-80 (Ac-RREVYDFAFRDLCIV YRDGN PYA VCDKCLKFYSKI-NH2..), E6 81-115 (Ac-SEYRHYCYSLYGTTLEQQYNK PLCDLLIRCINCQK-NH2..), and E6 116-158 (Ac-PLCPEEKQRHLDKKQRFHNIRGRWT GRCMSCCRSSRTRRETQL-NH2..) (U.S. Pat. No. 8,652,482). Commercially produced cGMP-grade peptides (CPC Scientific, San Jose, Calif.) will be examined..”
February 15th, 2018Citations, GMP Peptide ManufacturingDekker, Petrus Jacobus Theodorus, René Marcel De Jong, and Cornelis Marinus Muijlwijk. U.S. Patent Application No. 14/397,866.
"The internal standard (ISTD) WIL*GDVFIREYYSV*FDR was ordered from CPC Scientific (Sunnyvale, Calif., USA) and contained L*6×13C 1×15N and V*5×13C 1×15N. The ISTD contained an internal trypsin cleavage site in order to monitor the digestion with trypsin to completion."
November 21st, 2017Citations, Isotope-Labeled Peptides



