"The peptides, shown in Figure 1, were designed and synthesized. MPER (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), TT peptide (FNNFTVSFWLRVPKVSASHLE), T10HE peptide (FNNFTVSFWLRVPKVSASHLE-PEG2-LWNWF-S5-ITN-S5-LWYIR-PEG2-KK), and T10E peptide (FNNFTVSFWLRVPKVSASHLEPEG2-LWNWFDITNWLWYIR-PEG2-KK) were purchased from CPC Scientific Inc. (Sunnyvale, CA, USA)."

Abstract

Recent studies have demonstrated that the membrane-proximal external region (MPER) of human immunodeficiency virus 1 (HIV-1) glycoprotein 41 contains a series of epitopes for human monoclonal antibodies, including 2F5, Z13e1, 4E10, and 10E8, which were isolated from HIV-1-infected individuals and show broad neutralizing activities. This suggests that MPER is a good target for the development of effective HIV-1 vaccines. However, many studies have shown that it is difficult to induce antibodies with similar broad neutralizing activities using MPER-based peptide antigens. Here, we report that 10E8-like neutralizing antibodies with effective anti-HIV-1 activity were readily induced using a precisely designed conformational immunogenic peptide containing the 10E8-specific epitope. This immunogenic peptide (designated T10HE) contains a 15-mer MPER-derived 10E8-specific epitope fused to T-helper-cell epitopes from tetanus toxin (tt), which showed a significantly stabilized α-helix structure after a series of modifications, including substitution with an (S)-α-(2′-pentenyl) alanine containing an olefin-bearing tether and ruthenium-catalyzed olefin metathesis, compared with the unmodified T10E peptide. The stabilized α-helix structure of T10HE did not affect its capacity to bind the 10E8 antibody, as evaluated with an enzyme linked immunosorbent assay (ELISA) and surface plasmon resonance binding assay (SPR assay). The efficacies of the T10HE and T10E epitope vaccines were evaluated after a standard vaccination procedure in which the experimental mice were primed with either the T10HE or T10E immunogen and boosted with HIV-1 JRFL pseudoviruses. Higher titers of 10E8-like antibodies were induced by T10HE than that by T10E. More importantly, the antibodies induced by T10HE showed enhanced antiviral potency against HIV-1 strains with both X4 and R5 tropism and a greater degree of broad neutralizing activity than the antibodies induced by T10E. These results indicate that a 10E8-epitope-based structure-specific peptide immunogen can elicit neutralizing antibodies when used as a vaccine prime.

SOCIAL MEDIA

Connect with us and stay updated by following our social media channels.

Latest Briefings from our Knowledge Center

Press Releases, Industry News, Articles, and Technical Content

  • Joseph Denby interview on peptide and oligonucleotide manufacturing at NextGen Biomed 2025

    Gain insights from Joseph Denby's rapid-fire Q&A spotlight at NextGen Biomed, where he explores the landscape of peptide and oligo APIs, as well as the role of green chemistry in manufacturing.

  • Dr. Shawn Lee, CEO and Founder of CPC Scientific, at our 2025 Company Meeting

    Home / Knowledge Center / Articles

    Highlights from CPC Scientific’s 2025 Annual Conference

    GMP Peptide Manufacturing

    We’re excited to share the key moments from CPC Scientific’s 2025 Annual Conference!

    Hosted in San Jose, California, our annual gathering brought together colleagues from various teams and timezones for meaningful updates, focused […]

    March 28th, 2025Articles
  • Nextgen Biomed 2025 Joseph Denby

    At NextGen Biomed 2025, Joseph Denby delivered a cutting-edge presentation highlighting the critical role green chemistry plays in the sustainable production of peptide APIs and peptide–oligo conjugates...

    March 17th, 2025Articles
  • CPC Scientific DCAT Dinner 2025 with Theresa Cheng, Tim Nieters, and Diego Silva

    Home / Knowledge Center / Articles

    CPC Scientific at DCAT 2025!

    GMP Peptide Manufacturing

    What an amazing time we had at DCAT 2025! It was fantastic to meet with colleagues, clients, and friends, and showcase CPC Scientific’s cutting-edge capabilities in synthetic API development and commercial production.

    A heartfelt […]

    March 14th, 2025Articles
  • ISO 22716:2007(E) Cosmetic Guidelines

    We are excited to share that CPC Scientific Inc. has officially received the Good Manufacturing Practice (GMP) Certificate in accordance with the ISO 22716:2007(E) Cosmetic Guidelines.

    This certification highlights our unwavering commitment to delivering the highest quality peptide ingredients for cosmetic use, guaranteeing:

    • Superior Quality Control – Striving for excellence in safety, consistency, and purity.
    • Global […]
    February 5th, 2025Press Releases
  • Green Synthesis of Goserelin Impurity E

    In Part 1 of our Minimal Protection Group Strategies for SPPS, we discussed methods for eliminating sidechain protection on hydroxy-bearing amino acids such as serine, threonine, tyrosine, and hydroxyproline. By omitting t-butyl protection, we enhanced atom economy and avoided the use of hazardous solvents typically required to remove these protection groups. In Part 2, we present a new case study, expanding our approach to include the unprotected side chains of histidine, tryptophan, and arginine. We demonstrate the synthesis of a Goserelin peptide API impurity, showcasing how a convergent peptide fragment strategy can be used to eliminate the need for TFA and diethyl ether, eliminate side chain protection of Arginine, Histidine, and Tryptophan.

    January 31st, 2025publications, White Papers
  • RP-182 Synthesis by click chemistry

    The synthesis of the linear RP-182 analog, bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-PEG2-Lys-Phe-Arg-Lys-Ala-Phe-Lys-Arg-Phe-Phe-Lys(azido-PEG)-NH2, was achieved using standard solid-phase peptide synthesis (SPPS) protocols. After cleaving the linear peptide from the resin, macrocyclization was performed in the liquid phase through a strain-promoted click reaction. BCN introduces extra ring strain due to its fused cyclopropane structure. The combined effect of ring strain, the selection of BCN, and copper catalysis significantly increases the macrocyclization efficiency of longer peptides like RP-182.

  • Nakagawa, Mayumi, Teresa Evans, Milan Bimali, Hannah Coleman, Jasmine Crane, Nadia Darwish, Jennifer L. Faulkner et al. MedRxiv (2025): 2025-01.

    The vaccine consisted of four current good manufacturing production-grade synthetic peptides covering the HPV 16 E6 protein [amino acid (aa)1-45, 46-80, 81-115, and 116-158] (CPC Scientific, San Jose, CA [..]

  • triple-stapled peptide case study Zhan cat

    Stapled peptides have emerged as a powerful tool in drug discovery and therapeutic development due to their ability to overcome the limitations associated with traditional peptide drugs, such as poor stability and low cell permeability. By introducing staples into the peptide backbone, researchers can stabilize peptide conformations and enhance their interactions with target proteins, resulting in improved efficacy and specificity. This approach not only addresses the challenges of peptide drug design but also opens new avenues for targeting challenging biomolecular interactions that are difficult to modulate with small molecules or antibodies. The development of stapled peptides has led to significant advancements in targeting protein-protein interactions, addressing previously intractable diseases, and enhancing the precision of therapeutic interventions.

Contact Us